Sprachen als Schlüssel zur Vergangenheit

Sprachen als Schlüssel zur Vergangenheit

Talk presented at the Lange Nacht der Wissenschaften (Jena, 2019-11-23).

E01961dd2fbd219a30044ffe27c9fb70?s=128

Johann-Mattis List

November 23, 2019
Tweet

Transcript

  1. 1.

    Sprachen als Schlüssel zur Vergangenheit Johann-Mattis List Forschungsgruppe «Computergestützter Sprachvergleich»

    Abteilung für linguistische und kulturelle Evolution Max-Planck-Institut für Menschheitsgeschichte Jena, Deutschland 2019-11-22 very long title P(A|B)=P(B|A)... 1 / 50
  2. 2.
  3. 3.

    A A G T C T A G G T

    T A C C C G T A T Time (s) 0.4 2 -0.5396 0.3128 0 Do languages grow on trees? Spure� der Vergangenhei� 2 / 50
  4. 4.

    A A G T C T A G G T

    T A C C C G T A T Time (s) 0.4 2 -0.5396 0.3128 0 Do languages grow on trees? Spure� der Vergangenhei� 2 / 50
  5. 5.

    A A G T C T A G G T

    T A C C C G T A T Spure� der Vergangenhei� Time (s) 0.4 2 -0.5396 0.3128 0 Do languages grow on trees? 2 / 50
  6. 6.
  7. 7.

    Inhalt 1 Sprachwandel Sprachwandel im Alltag Sprachwandel als Sprachverfall Sprachwandel

    in der Forschung 2 Klassischer Sprachvergleich Die komparative Methode Die phylogenetische Rekonstruktion Erkenntnisse 3 Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Grundlegendes Erkenntnisse 4 Jenseits von Sprachwandel 5 Ausblick 3 / 50
  8. 9.

    "Die Sprachen [ändern] sich [...] so lange sie leben.." (August

    Schleicher 1863) walkman Indogermanisch Germanisch Altenglisch Englisch p f f f ə a æ ɑː t d d ð eː eː e ə r r r r iPod Sprachwandel 4 / 50
  9. 10.

    "Die Sprachen [ändern] sich [...] so lange sie leben.." (August

    Schleicher 1863) walkman Indogermanisch Germanisch Altenglisch Englisch p f f f ə a æ ɑː t d d ð eː eː e ə r r r r iPod Sprachwandel 4 / 50
  10. 11.

    "Die Sprachen [ändern] sich [...] so lange sie leben.." (August

    Schleicher 1863) walkman Indogermanisch Germanisch Altenglisch Englisch p f f f ə a æ ɑː t d d ð eː eː e ə r r r r iPod Sprachwandel 4 / 50
  11. 12.

    "Die Sprachen [ändern] sich [...] so lange sie leben.." (August

    Schleicher 1863) walkman Indogermanisch Germanisch Altenglisch Englisch p f f f ə a æ ɑː t d d ð eː eː e ə r r r r iPod Sprachwandel 4 / 50
  12. 19.
  13. 20.

    Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Küchenetymologien konservativ Wortart

    Adjektiv Häufigkeit moderat Bedeutung «am Hergebrachten, Her- kömmlichen, Überlieferten hängend, festhaltend» Synonyme «bewahrend», «erhaltend», «ohne Operation» Aussprache ˈkɔnzɛrvatiːf Ursprung Englisch conservative 8 / 50
  14. 21.

    Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Küchenetymologien Englisch conservative

    «antiquiert» Mittellatin conservativus «beschützend» Latein conservare «bewahren» Urromanisch *serwo- «Hirte» Urindogermanisch *ser-u-o «Beschützer» Adamische Sprache ??? «?» 8 / 50
  15. 22.

    Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Küchenetymologien Konserve Wortart

    Substantiv Häufigkeit moderat Bedeutung «in einer [...] Büchse oder in einem Glas aufbewahrtes Nah- rungsmittel [...]» Synonyme «bewahrend», «erhaltend», «ohne Operation» Aussprache kɔnzˈɛrvə Ursprung Mittellatein conserva 8 / 50
  16. 23.

    Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Küchenetymologien Mittellatein conserva

    «antiquiert» Mittellatein conserva «Eingelegtes» Latein conservare «bewahren» Urromanisch *serwo- «Hirte» Urindogermanisch *ser-u-o «Beschützer» Adamische Sprache ??? «?» 8 / 50
  17. 24.

    Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Küchenetymologien Deutsch konservativ

    «antiquiert» Deutsch konservativ «antiquiert» Latein conservare «bewahren» Latein conservare «shepherd» Deutsch Konserve «Nahrungsmittelbüchse» Latein conservare «bewahren» 8 / 50
  18. 26.

    Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall Poeten der Tángzeit

    in China (618⚶906 n. Chr.) Philosophen im alten Griechenland (ab 400 v. Chr.) 9 / 50
  19. 27.

    Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall Poeten der Tángzeit

    in China (618⚶906 n. Chr.) Philosophen im alten Griechenland (ab 400 v. Chr.) Redner im alten Rom (ab 100 v. Chr.) 9 / 50
  20. 28.

    Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall Poeten der Tángzeit

    in China (618⚶906 n. Chr.) Philosophen im alten Griechenland (ab 400 v. Chr.) Redner im alten Rom (ab 100 v. Chr.) Moderne Sprachpfleger wie B. Sick (2004) 9 / 50
  21. 32.

    Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall: Macht das Sinn?

    machen ← Indogermanisch *mag- «kneten» engl. to make = dt. machen 10 / 50
  22. 36.

    Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall: Fallverlust Trotz dem

    Dativ hat der Genitiv noch eine Chance! Ursprünglich: trotz + Dativ seit ca. 1800: trotz + Genitiv und trotz + Dativ 11 / 50
  23. 38.

    Sprachwandel Sprachwandel in der Forschung Sprachwandel in der Forschung Sprachwandel

    ist nicht Sprachverfall. Sprachwandel ist allgegenwärtig und unvermeidbar. 12 / 50
  24. 39.

    Sprachwandel Sprachwandel in der Forschung Sprachwandel in der Forschung Sprachwandel

    ist nicht Sprachverfall. Sprachwandel ist allgegenwärtig und unvermeidbar. Sprachwandel folgt in Teilen universellen Tendenzen und Trends. 12 / 50
  25. 40.

    Sprachwandel Sprachwandel in der Forschung Sprachwandel in der Forschung Sprachwandel

    ist nicht Sprachverfall. Sprachwandel ist allgegenwärtig und unvermeidbar. Sprachwandel folgt in Teilen universellen Tendenzen und Trends. Sprachwandel verläuft in Teilen systematisch. 12 / 50
  26. 41.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Pfanne Pfund

    Pfau Apfel Hopfen Fanne Fund Fau Apfel Hopfen pan pound peacock apple hop 13 / 50
  27. 42.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Pfanne Pfund

    Pfau Apfel Hopfen Fanne Fund Fau Apfel Hopfen pan pound peacock apple hop 13 / 50
  28. 43.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Pfanne Pfund

    Pfau Apfel Hopfen Fanne Fund Fau Apfel Hopfen pan pound peacock apple hops 13 / 50
  29. 44.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Pfanne Pfund

    Pfau Apfel Hopfen Fanne Fund Fau Apfel Hopfen pan pound peacock apple hops p → pf → f 13 / 50
  30. 45.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Jacob Grimm

    Rasmus Rask Undersøgelse om det gamle Nordiske Sprogs Oprindelse 1818 Deutsche Grammatik (Ausgabe II) 1822 Icelandic Sanskrit Old Greek Latin 13 / 50
  31. 46.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Icelandic Old

    Indian Old Greek Latin Sanskrit Jacob Grimm Rasmus Rask Undersøgelse om det gamle Nordiske Sprogs Oprindelse 1818 Deutsche Grammatik (Ausgabe II) 1822 13 / 50
  32. 47.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Icelandic Old

    Indian Old Greek Latin Sanskrit Indo-European Method for Language Comparison • intensive language comparison • identify regularly recurring similaritities → prove language relationship → reconstruct development of language families Jacob Grimm Rasmus Rask Undersøgelse om det gamle Nordiske Sprogs Oprindelse 1818 Deutsche Grammatik (Ausgabe II) 1822 13 / 50
  33. 48.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Old Indian

    Old Greek Latin pe d- πο d- pā da "Fuß" Icelandic fó tur fótur ped- ποd- pāda 13 / 50
  34. 49.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Old Indian

    Old Greek Latin "Fuß" Icelandic fótur ped- ποd- pāda pāda fótur pet- ποd- ótur ed- οd- āda Icelandic Latin Old Greek Old Indian f p π p itar- f p π p aðir ater atήr 13 / 50
  35. 50.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Old Indian

    Old Greek Latin Icelandic faðir pater πatήr pitar- "Vater" faðir pater πatήr pitar- ótur ed- οd- āda Icelandic Latin Old Greek Old Indian f p π p itar- f p π p aðir ater atήr 13 / 50
  36. 51.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Old Indian

    Old Greek Latin Icelandic faðir pater πatήr pitar- "Vater" ótur ed- οd- āda Icelandic Latin Old Greek Old Indian f p π p itar- f p π p aðir ater atήr 13 / 50
  37. 52.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel: Lautgesetze Aller

    lautwandel, soweit er mechanisch vor sich geht, vollzieht sich nach ausnahmslosen gesetzen, d.h. die richtung der lautbewegung ist bei allen angehörigen einer sprachgenossenschaft, ausser dem Fall, dass dialektspaltung eintritt, stets dieselbe, und alle wörter, in denen der der lautbewegung unterworfene laut unter gleichen verhältnissen erscheint, werden ohne ausnahme von der änderung ergriffen. (Osthoff und Brugmann 1878: XIII) 14 / 50
  38. 54.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel: Wandel des

    Alphabets Was ist das für ein Buchstabe? Das ist ein P. 15 / 50
  39. 55.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel: Wandel des

    Alphabets Was ist das für ein Buchstabe? Das ist ein P. Ich püsse euch alle, ganz besonders Averell, meinen Pleinen. Das reicht! 15 / 50
  40. 56.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel: Wandel des

    Alphabets Was ist das für ein Buchstabe? Das ist ein P. Ich püsse euch alle, ganz besonders Averell, meinen Pleinen. Das reicht! Aber wohin gehen wir, wenn man uns wieder einfängt? Plappe Pleiner! 15 / 50
  41. 57.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel: Wandel des

    Alphabets Was ist das für ein Buchstabe? Das ist ein P. Ich püsse euch alle, ganz besonders Averell, meinen Pleinen. Das reicht! Aber wohin gehen wir, wenn man uns wieder einfängt? Plappe Pleiner! Liebe Kinder, heute habe ich Lucky Luke getroffen. Ich küsse euch, ganz besonders Averell, meinen Kleinen! Eure Ma Dalton 15 / 50
  42. 58.

    Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel: Wandel des

    Alphabets Was ist das für ein Buchstabe? Das ist ein P. Ich püsse euch alle, ganz besonders Averell, meinen Pleinen. Das reicht! Aber wohin gehen wir, wenn man uns wieder einfängt? Plappe Pleiner! Liebe Pinder, heute habe ich Lucpy Lupe getroffen. Ich püsse euch, ganz besonders Averell, meinen Pleinen! Eure Ma Dalton 15 / 50
  43. 60.

    [Der historische Sprachvergleich] hat es mit den trockensten Einzelthatsachen zu

    thun [...]. Was sonst die Wissenschaft von den Sprachen [...] zu einer der lebensvollsten macht, das tritt hier zunächst zurück. [...] Der Sprachhistoriker steht draußen vor seinem Gegenstande: hier der Anatom, da der Cadaver. Georg von der Gabelentz (1891) Klassischer Sprachvergleich 16 / 50
  44. 61.

    [Der historische Sprachvergleich] hat es mit den trockensten Einzelthatsachen zu

    thun [...]. Was sonst die Wissenschaft von den Sprachen [...] zu einer der lebensvollsten macht, das tritt hier zunächst zurück. [...] Der Sprachhistoriker steht draußen vor seinem Gegenstande: hier der Anatom, da der Cadaver. Georg von der Gabelentz (1891) Klassischer Sprachvergleich 16 / 50
  45. 62.

    [Der historische Sprachvergleich] hat es mit den trockensten Einzelthatsachen zu

    thun [...]. Was sonst die Wissenschaft von den Sprachen [...] zu einer der lebensvollsten macht, das tritt hier zunächst zurück. [...] Der Sprachhistoriker steht draußen vor seinem Gegenstande: hier der Anatom, da der Cadaver. Georg von der Gabelentz (1891) Klassischer Sprachvergleich 16 / 50
  46. 65.
  47. 66.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode Offiziell: Die

    Kernmethode des historischen Sprachvergleichs. Das unantastbare Fundament, auf dem die historische Linguistik steht. 17 / 50
  48. 67.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode Offiziell: Die

    Kernmethode des historischen Sprachvergleichs. Das unantastbare Fundament, auf dem die historische Linguistik steht. Tatsächlich: 17 / 50
  49. 68.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode Offiziell: Die

    Kernmethode des historischen Sprachvergleichs. Das unantastbare Fundament, auf dem die historische Linguistik steht. Tatsächlich: Ein Oberbegriff für ein Sammelsurium an verschiedenen kaum standardisierten Techniken, die beständig weiterentwickelt werden. 17 / 50
  50. 69.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode Offiziell: Die

    Kernmethode des historischen Sprachvergleichs. Das unantastbare Fundament, auf dem die historische Linguistik steht. Tatsächlich: Ein Oberbegriff für ein Sammelsurium an verschiedenen kaum standardisierten Techniken, die beständig weiterentwickelt werden. Besser verstanden als ein Coverterm für alle Methoden des historischen Sprachvergleichs. 17 / 50
  51. 71.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Kognaten und

    Korrespondenzen Nase Nass Muse muss singen m → b n → d ng → g ss → f s → w 18 / 50
  52. 72.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Kognaten und

    Korrespondenzen Nase Nass Muse muss singen Dase Dass Buse buss sigen Nawe Naf Muwe muf wingen 18 / 50
  53. 73.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Kognaten und

    Korrespondenzen *Nase *Nass *Muse *muss *singen Dase Dass Buse buss sigen Nawe Naf Muwe muf wingen 18 / 50
  54. 74.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... irreguläre Korrespondenz! 19 / 50
  55. 75.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... irreguläre Korrespondenz! 19 / 50
  56. 76.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... 19 / 50
  57. 77.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... 19 / 50
  58. 78.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... 19 / 50
  59. 79.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... 19 / 50
  60. 80.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... 19 / 50
  61. 81.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... irreguläre Korrespondenz! 19 / 50
  62. 83.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Fazit Dank

    der Systematizität des Sprachwandels können wir im Rahmen des historischen Sprachvergleichs relativ sicher verwandte (kognate) Wörter ermitteln. 20 / 50
  63. 84.

    Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Fazit Dank

    der Systematizität des Sprachwandels können wir im Rahmen des historischen Sprachvergleichs relativ sicher verwandte (kognate) Wörter ermitteln. Obwohl das Verfahren zum Ermitteln von Lautkorrespondenzen und kognaten Wörtern sehr formal gefasst und beschrieben werden kann, wird es vorwiegend manuell ausgeführt. 20 / 50
  64. 86.

    Klassischer Sprachvergleich Die phylogenetische Rekonstruktion Die phylogenetische Rekonstruktion Unter phylogenetischer

    Rekonstruktion verstehen wir den Versuch, die Entwicklung einer Sprachfamilie in Form von Stammbäumen darzustellen. 21 / 50
  65. 87.

    Klassischer Sprachvergleich Die phylogenetische Rekonstruktion Die phylogenetische Rekonstruktion Unter phylogenetischer

    Rekonstruktion verstehen wir den Versuch, die Entwicklung einer Sprachfamilie in Form von Stammbäumen darzustellen. Die klassische phylogenetische Rekonstruktion in der Linguistik ist der Kladistik sehr ähnlich, wurde aber viel früher entwickelt. 21 / 50
  66. 88.

    Klassischer Sprachvergleich Die phylogenetische Rekonstruktion Die phylogenetische Rekonstruktion Unter phylogenetischer

    Rekonstruktion verstehen wir den Versuch, die Entwicklung einer Sprachfamilie in Form von Stammbäumen darzustellen. Die klassische phylogenetische Rekonstruktion in der Linguistik ist der Kladistik sehr ähnlich, wurde aber viel früher entwickelt. Leider sind die Kriterien für die Verfahren kaum formalisiert und werden auch selten transparent angewendet. 21 / 50
  67. 89.

    Klassischer Sprachvergleich Die phylogenetische Rekonstruktion Die phylogenetische Rekonstruktion 1700 1800

    1750 1850 Stiernhielm's Lingua Nova 1671 Gallet's Arbre ca. 1800 Darwin's Origins 1859 De Buffon's Table 1755 Schleicher's Stammbaum 1853 Darwin's Tree Sketch 1837 Lamarck's Tableaux 1809 Čelakovský's Rodový Kmen 1853 Rühling's Tabula 1774 Hicke's Affinitas 1689 Schottel's Tabelle 1663 List et al. (2016) 22 / 50
  68. 90.

    Klassischer Sprachvergleich Die phylogenetische Rekonstruktion Die phylogenetische Rekonstruktion 1700 1800

    1750 1850 Stiernhielm's Lingua Nova 1671 Gallet's Arbre ca. 1800 Darwin's Origins 1859 De Buffon's Table 1755 Schleicher's Stammbaum 1853 Darwin's Tree Sketch 1837 Lamarck's Tableaux 1809 Čelakovský's Rodový Kmen 1853 Rühling's Tabula 1774 Hicke's Affinitas 1689 Schottel's Tabelle 1663 List et al. (2016) 22 / 50
  69. 91.

    Klassischer Sprachvergleich Die phylogenetische Rekonstruktion Die phylogenetische Rekonstruktion 1700 1800

    1750 1850 Stiernhielm's Lingua Nova 1671 Gallet's Arbre ca. 1800 Darwin's Origins 1859 De Buffon's Table 1755 Schleicher's Stammbaum 1853 Darwin's Tree Sketch 1837 Lamarck's Tableaux 1809 Čelakovský's Rodový Kmen 1853 Rühling's Tabula 1774 Hicke's Affinitas 1689 Schottel's Tabelle 1663 List et al. (2016) Schleicher's Stammbaum 1853 22 / 50
  70. 93.

    Klassischer Sprachvergleich Erkenntnisse Erkenntnisse des klassischen Sprachvergleichs: Etymologie Frucht, ferner

    fruchten, befruchten, Befruchtung, fruchtbar, fruchtig Frucht f. ‘der Fortpflanzung der eigenen Art dienendes Produkt einer Pflanze’, auch ‘ungeborenes Lebewesen’, übertragen ‘Ertrag’, ahd. fruht (9. Jh.), mhd. vruht, asächs. fruht, mnd. mnl. nl. vrucht beruhen auf einer frühen Entlehnung von gleichbed. lat. frūctus, abgeleitet vom Verb lat. fruī (frūctus sum) ‘genießen, Nutzen ziehen’ (verwandt mit brauchen, s. d.). Das Deminutiv Früchtchen hat die spezielle Bedeutung [...] Dt. «Frucht» in Pfei�er (1993, auch unter https://dwds.de) 24 / 50
  71. 94.

    Klassischer Sprachvergleich Erkenntnisse Erkenntnisse des klassischen Sprachvergleichs: Etymologie Frucht, ferner

    fruchten, befruchten, Befruchtung, fruchtbar, fruchtig Frucht f. ‘der Fortpflanzung der eigenen Art dienendes Produkt einer Pflanze’, auch ‘ungeborenes Lebewesen’, übertragen ‘Ertrag’, ahd. fruht (9. Jh.), mhd. vruht, asächs. fruht, mnd. mnl. nl. vrucht beruhen auf einer frühen Entlehnung von gleichbed. lat. frūctus, abgeleitet vom Verb lat. fruī (frūctus sum) ‘genießen, Nutzen ziehen’ (verwandt mit brauchen, s. d.). Das Deminutiv Früchtchen hat die spezielle Bedeutung [...] ererbt von entlehnt von abgeleited von PIE *bhreu◌◌◌̯ Hg◌ ◌ ◌ ̑ - «benutzen» PIE *bhruHg◌ ◌ ◌ ̑ -ié- «benutzen» (Präsens) Urg. *ƀrūkan- «benutzen» AHD brūhhan «benutzen» D brauchen «brauchen» D Brauch «Brauch» AHD fruht «Gewinn, Frucht» D frugal «spärlich» Fr fruit “profit,fruit” Fr frugal “modest (food)” Lt fruor, fruī «ich genieße» Lt frūctus «Gewinn» Lt frux «Frucht, Korn» Lt frugalis «Nutzen bringend» Nach einer Illustration von Hans Geisler (Universität Düsseldorf) [...] Deutsch «Frucht» in Pfei�er (1993, auch unter https://dwds.de) 24 / 50
  72. 96.

    Klassischer Sprachvergleich Erkenntnisse Erkenntnisse des klassischen Sprachvergleichs: Phylogenie Sino-Tibetan Indo-European

    Afro-Asiatic Niger-Congo Austronesian Pama-Nyungan Otomanguean Arawakan Na-Dené Uralic Algonquian 25 / 50
  73. 99.

    Sprachfamilien wie Sinotibetisch stellen "nahezu unüberwindbare Hindernisse" dar. (Antoine Meillet

    1925) Einsichten → Sprachwandel → Menschheitsgeschichte → Faktoren von Diversität in Sprache und Kultur → klassische Methoden stoßen an Grenzen → rein automatische Methoden ersetzen keine Expertenerfahrung und -intuition Hindernisse steigender Umfang von Datenmengen historischer Sprachvergleich große und diverse Sprachfamilien Heraus- forderungen Computergestützte Sprachforschung 26 / 50
  74. 100.

    Sprachfamilien wie Sinotibetisch stellen "nahezu unüberwindbare Hindernisse" dar. (Antoine Meillet

    1925) Einsichten → Sprachwandel → Menschheitsgeschichte → Faktoren von Diversität in Sprache und Kultur → klassische Methoden stoßen an Grenzen → rein automatische Methoden ersetzen keine Expertenerfahrung und -intuition Hindernisse steigender Umfang von Datenmengen historischer Sprachvergleich große und diverse Sprachfamilien Heraus- forderungen Computergestützte Sprachforschung 26 / 50
  75. 101.

    Sprachfamilien wie Sinotibetisch stellen "nahezu unüberwindbare Hindernisse" dar. (Antoine Meillet

    1925) Einsichten → Sprachwandel → Menschheitsgeschichte → Faktoren von Diversität in Sprache und Kultur → klassische Methoden stoßen an Grenzen → rein automatische Methoden ersetzen keine Expertenerfahrung und -intuition Hindernisse steigender Umfang von Datenmengen historischer Sprachvergleich große und diverse Sprachfamilien Heraus- forderungen Computergestützte Sprachforschung 26 / 50
  76. 104.

    Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Probleme des klassischen Sprachvergleichs

    fehlende Empirie (Lobpreis der Intuition) fehlende Fokussierung (mangelnde Interdisziplinarität) 27 / 50
  77. 105.

    Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Probleme des klassischen Sprachvergleichs

    fehlende Empirie (Lobpreis der Intuition) fehlende Fokussierung (mangelnde Interdisziplinarität) fehlende Transparenz der Analysen 27 / 50
  78. 106.

    Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Probleme des klassischen Sprachvergleichs

    fehlende Empirie (Lobpreis der Intuition) fehlende Fokussierung (mangelnde Interdisziplinarität) fehlende Transparenz der Analysen mangelnde Effizienz der Anwendung 27 / 50
  79. 112.

    Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Die quantitative Wende: Tragödie

    oder Schnulze? 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 10 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ?! ? 29 / 50
  80. 113.

    Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Die quantitative Wende: Tragödie

    oder Schnulze? 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 10 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 29 / 50
  81. 118.

    Computergestützte Sprachforschung Grundlegendes Grundlegendes zum computergestützten Sprachvergleich phylogenetische Rekonstruktion (Stammbäume,

    Datierung von Sprachfamilien) automatisierte Ansätze zur Etymologie (Erkennung von kognaten Wörtern, Alinierung, Ermittlung von Lautkorrespondenzen) 31 / 50
  82. 122.

    Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (im Alltag) Taxon N. Sequence

    PLAGIARY 1 die Zurueckhaltung die im Umgang mit dem Foederalismusbegriff ORIGINAL 1 die Zurueckhaltung die im Umgang mit dem Foederalismusbegriff PLAGIARY 2 zu beobachten ist mag zu einem gewissen ..Teil. darauf zuruec ORIGINAL 2 zu beobachten ist mag ..........n.ich.t zuletzt darauf zuruec PLAGIARY 3 kzufuehren sein dass sich ...waehre.nd. des 19 Jahrhunderts e ORIGINAL 3 kzufuehren sein dass sich im v.e.r.lauf des 19 Jahrhunderts e HTL2 1 LDTAPCLFSDGS PQKAAYVLWDQTIL QQDITPLPSHETHSA QKGELLALIC Type (1) Plagiaterkennung (Ausschnitt von Guttenbergs Dissertation) 33 / 50
  83. 123.

    Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (im Alltag) Taxon N. Sequence

    HTL2 1 LDTAPCLFSDGS‑‑‑‑‑‑PQKAAYVLWDQTIL‑‑‑QQDITPLPSHETHSA QKGELLALIC MMLV 1 PDADHTWYTDGSSLLQEGQRKAGAAVTTETEVIWAKALDAG‑‑‑T‑‑‑SAQRAELIALTQA HTL2 2 GLRAAKPWPSLNIFLDSKYLIKYLHSLAIGAFLGTSAH‑‑‑‑‑‑‑‑‑QT‑LQAALPPLLQG MMLV 2 LKMAEGKK‑LNVYTDSRYAFATAHIHGEIYRRRGLLTSEGKEIKNKDE‑ILALLKALFLPK HTL2 3 KTIYLHHVRSHT‑NLPDPISTFNEYTDSLILAPL‑‑‑‑‑‑‑‑‑‑ MMLV 3 RLSIIHCPGHQ‑KGHSAEARGNRMADQAARKAAITETPDTSTLL Type (1) Sequenzvergleich in der Biologie 33 / 50
  84. 124.

    Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (im Alltag) Taxon N. Sequence

    WRONG 1 two b‑ or not two b‑ that is the question CORRECT 1 t‑o be or not t‑o be that is the question WRONG 2 Leavins‑t‑ine distance is the addict distance betwean strings CORRECT 2 Le‑venshtein‑ distance is the ed‑i‑t distance between strings WRONG 3 ”ad‑ress” ”concensus” and ”dependance” are of‑en misspelled CORRECT 3 ”address” ”consensus” and ”dependence” are often misspelled Type (1) Rechtschreibkorrektur 33 / 50
  85. 127.

    Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (in der Linguistik) Alinierungsanalysen sind

    relativ leicht automatisierbar, fördern die Transparenz der vergleichenden Sprachforschung, 34 / 50
  86. 128.

    Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (in der Linguistik) Alinierungsanalysen sind

    relativ leicht automatisierbar, fördern die Transparenz der vergleichenden Sprachforschung, können durch interaktive Software auch leicht manuell nachkorrigiert werden und 34 / 50
  87. 129.

    Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (in der Linguistik) Alinierungsanalysen sind

    relativ leicht automatisierbar, fördern die Transparenz der vergleichenden Sprachforschung, können durch interaktive Software auch leicht manuell nachkorrigiert werden und sind daher ein perfektes Beispiel für computergestützte (im Gegensatz zu computerbasierter) Sprachforschung. 34 / 50
  88. 141.

    Computergestützte Sprachforschung Grundlegendes Grundlegendes: Wörtervorhersage Experiment mit Tim Bodt (Feldforscher,

    sinotibetische Sprachen in Indien und Nepal) automatisierter Vergleich von vorhandenen Sprachdaten, um noch nicht elizitierte Wörter vorherzusagen Registrierung des Experiments, bevor Tim die Feldforschung wieder aufnahm Evaluierung der Vorhersagegüte: 75% mit Korrektur durch den Experten, 70% rein automatisch 37 / 50
  89. 144.
  90. 145.

    Computergestützte Sprachforschung Grundlegendes Grundlegendes: Phylogenetische Rekonstruktion Grundfragen der phylogenetischen Rekonstruktion:

    Wie alt ist eine Sprachfamilie? Welche Wörter wurden in der Ursprache gesprochen? Wo sind Wörter erhalten geblieben, wo verloren gegangen? 38 / 50
  91. 146.

    Computergestützte Sprachforschung Grundlegendes Grundlegendes: Phylogenetische Rekonstruktion Grundfragen der phylogenetischen Rekonstruktion:

    Wie alt ist eine Sprachfamilie? Welche Wörter wurden in der Ursprache gesprochen? Wo sind Wörter erhalten geblieben, wo verloren gegangen? Was sagt uns das Vokabular der Ursprache über die ursprüngliche Gemeinschaft der Sprecher? 38 / 50
  92. 147.

    Computergestützte Sprachforschung Grundlegendes Grundlegendes: Phylogenetische Rekonstruktion Fúzhōu Táiběi Xiàmén Zhāngpíng

    Mǐn Guǎngzhōu Měixiàn Liánchéng Hakka Wēnzhōu Níngbō Sūzhōu Shànghǎi Shànghǎi_B Wú Nánchāng Ānyì Gàn Chángshā Shuāngfēng Xiāng Yàngshān Wǔhàn Níngxià Chéngdū Běijīng Tàiyuán Yúcì Guānhuà 月 月娘 月光佛 月光 月亮 月明 ‘MOON’ ‘MOON-MOTHER’ ‘MOON-LIGHT’ ‘MOON-LIGHT-SUFFIX’ ‘MOON-SHINE’ ‘MOON-BRIGHT’ Geschichte des Worts für «Mond» in chinesischen Dialekten (List 2016) 39 / 50
  93. 149.

    Computergestützte Sprachforschung Erkenntnisse Erkenntnisse des computergestützten Sprachvergleichs #MLGA (Make Linguistics

    Great Again!) Der Bann von Sprachursprungsfragen durch die Société de Linguistique de Paris: Die Gesellschaft gestattet keinerlei Diskussion zum Ursprung der Sprache oder zur Erschaffung einer Universalsprache. («Statuts» 1871: III, meine Übersetzung) 40 / 50
  94. 150.

    Computergestützte Sprachforschung Erkenntnisse Erkenntnisse des computergestützten Sprachvergleichs #MLGA (Make Linguistics

    Great Again!) Der Bann von Sprachursprungsfragen durch die Société de Linguistique de Paris: Die Gesellschaft gestattet keinerlei Diskussion zum Ursprung der Sprache oder zur Erschaffung einer Universalsprache. («Statuts» 1871: III, meine Übersetzung) Seit der quantitativen Wende stellen wir als Linguistik Betreibende neue Fragen oder trauen uns, lange nicht beachtete Fragen endlich wieder zu stellen. 40 / 50
  95. 151.

    Computergestützte Sprachforschung Erkenntnisse Erkenntnisse des computergestützten Sprachvergleichs Edit-Dist. SCA Infomap

    Bahnaric Chinese Huon Romance Tujia Uralic Turchin LexStat TOTAL true positive true negative false negative false positive Akkurazität automatischer Wortvergleiche (List et al. 2017) 41 / 50
  96. 153.

    Computergestützte Sprachforschung Erkenntnisse Erkenntnisse des computergestützten Sprachvergleichs Automatische Methoden sollen

    die Forschungskräfte nicht überflüssig machen. Sie sollen den Forschenden vielmehr durch das Übernehmen der langweiligen Aufgaben Zeit geben, sich wichtigeren Forschungsfragen zu widmen. 42 / 50
  97. 154.

    Computergestützte Sprachforschung Erkenntnisse Erkenntnisse des computergestützten Sprachvergleichs Automatische Methoden sollen

    die Forschungskräfte nicht überflüssig machen. Sie sollen den Forschenden vielmehr durch das Übernehmen der langweiligen Aufgaben Zeit geben, sich wichtigeren Forschungsfragen zu widmen. Als Beispiel dient hier die moderne Biologie, wie auch die computergestützten Übersetzung. 42 / 50
  98. 158.

    Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung Wie können, sollen,

    oder müssen wir uns ausdrücken? 1 Mir tut der Kopf weh. 44 / 50
  99. 159.

    Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung Wie können, sollen,

    oder müssen wir uns ausdrücken? 1 Mir tut der Kopf weh. 2 Mir dröhnt der Schädel. 44 / 50
  100. 160.

    Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung Wie können, sollen,

    oder müssen wir uns ausdrücken? 1 Mir tut der Kopf weh. 2 Mir dröhnt der Schädel. 3 Meine Rübe pocht. 44 / 50
  101. 161.

    Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung Wie können, sollen,

    oder müssen wir uns ausdrücken? 1 Mir tut der Kopf weh. 2 Mir dröhnt der Schädel. 3 Meine Rübe pocht. 4 Ich hab ein fieses Ziehen in der Stirn. 44 / 50
  102. 162.

    Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung One beer please!

    A beer for me! Beer? Please? You have beer? I'm thirsty, but I do not drink water, can you help me? I want the same as everybody else here. 45 / 50
  103. 165.

    Jenseits von Sprachwandel Jenseits von Sprachwandel: Polysemiedaten CLICS: Database of

    Cross-Linguistic Colexifications http://clics.clld.org List et al. (2019) Key Concept Russian German ... 1.1 world mir, svet Welt ... 1.21 earth, land zemlja Erde, Land ... 1.212 ground, soil počva Erde, Boden ... 1.420 tree derevo Baum ... 1.430 wood derevo Wald ... ... ... ... ... ... 46 / 50
  104. 166.

    Jenseits von Sprachwandel Jenseits von Sprachwandel: Polysemiedaten CLICS: Database of

    Cross-Linguistic Colexifications http://clics.clld.org List et al. (2019) Key Concept Russian German ... 1.1 world mir, svet Welt ... 1.21 earth, land zemlja Erde, Land ... 1.212 ground, soil počva Erde, Boden ... 1.420 tree derevo Baum ... 1.430 wood derevo Wald ... ... ... ... ... ... 46 / 50
  105. 167.

    Jenseits von Sprachwandel Jenseits von Sprachwandel: Polysemiedaten CLICS: Crosslinguistic Colexifications

    - 221 Sprachen - 64 Sprachfamilien - 1280 Konzepte - 301,498 Wörter - 45,667 Polysemien (Kolexifizierungen) - 16,239 unterschiedliche Links - http://clics.lingpy.org 46 / 50
  106. 168.

    Jenseits von Sprachwandel Jenseits von Sprachwandel: Polysemiedaten CLICS-2: Database of

    Cross-Linguistic Colexifications http://clics.clld.org List et al. (2018) >1000 languages >1500 concepts 46 / 50
  107. 169.

    Jenseits von Sprachwandel Jenseits von Sprachwandel: Polysemiedaten • • •

    • • • • • • • • • • • • • • • • • • • • • •• • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • • • •• • • • • • • • • • • • • • • • • −50 −25 0 25 50 0 100 200 300 Longitude Latitude Families • • • • • • • • • • • • • • • • • • • • Afro−Asiatic Arawakan Atlantic−Congo Austroasiatic Austronesian Cariban Dravidian Hmong−Mien Indo−European Matacoan Nakh−Daghestanian Other Pano−Tacanan Sino−Tibetan Tai−Kadai Tucanoan Tungusic Tupian Turkic Uralic 2271 Sprachen 200 Sprachfamilien 2901 Konzepte sehr viele Wörter (!) ... CLICS-3 46 / 50
  108. 170.

    Jenseits von Sprachwandel Jenseits von Sprachwandel: Polysemiedaten CLICS: Database of

    Cross-Linguistic Colexifications http://clics.clld.org List et al. (2018) CARRY IN HAND CARRY UNDER ARM RULE ORDER SALT TAKE CHOOSE LEND SHARE BRING FORGET ACQUIT HAVE SEX HAND LIBERATE DIRTY GUEST ARM BETWEEN UPPER ARM MOLD TORCH OR LAMP OWN GAP (DISTANCE) DRIP (EMIT LIQUID) FINGERNAIL OR TOENAIL RIVER KISS RAIN (PRECIPITATION) WHEN SPOON SUCK ROUND LICK FINGERNAIL CLAW SOUP DRINK FORK PITCHFORK WATER SEA OPEN SMOKE (INHALE) LET GO OR SET FREE CAUSE DIRT FORKED BRANCH SEND LIP FORGIVE UNTIE ANCHOR EAT BITE BEVERAGE SWALLOW SAP URINE ANKLE FISHHOOK WHEEL WHERE LIFT CHIEFTAIN LOWER ARM CAUSE TO (LET) QUEEN GIVE ELBOW DONATE ELECTRICITY SKY STORM CLOUDS MUD SWAMP SMOKE (EXHAUST) FRESH SMOKE (EMIT SMOKE) STRANGER CEASE MOORLAND HOST GO UP (ASCEND) WEDDING CLIMB CLOUD PALM OF HAND FIVE MARRY RISE (MOVE UPWARDS) WRIST KING PRESIDENT FATHOM COLLARBONE RIDE SPACE (AVAILABLE) MASTER SHOULDER BROOM RAKE FLESH HOOK DRIBBLE SPIT TOE PAW OCEAN FINGER LAKE EDGE OBSCURE TOP NIGHT INCREASE WORLD UP DARKNESS BE GOD CALF OF LEG LEG SHIN FISH LOWER LEG WOMAN FEMALE (OF PERSON) FEMALE FEMALE (OF ANIMAL) LAGOON CORNER BORDER BESIDE FRINGE BOUNDARY WIFE COAST POINTED SHARP SHORE PLACE (POSITION) END (OF SPACE) EARTH (SOIL) BLACK STAND UP CHEW MEAL BREAKFAST HEEL FOOD DINNER (SUPPER) FOOT STAR SAND CLAY STAND SHOULDERBLADE CRAWL WAKE UP FOG FINISH DARK MALE ICE WAIST MARRIED MAN HIP DEEP LUNG FOAM REMAINS BLUE WAIT (FOR) LIFE LATE BE ALIVE AFTER TOWN BEHIND ASH FLOUR STATE (POLITICS) NEW UPPER BACK BOTTOM PASTURE THATCH BUTTOCKS MAN MALE (OF ANIMAL) MALE (OF PERSON) SIT DOWN TALL CROUCH EVENING AFTERNOON HIGH WEST GROW MAINLAND SIT LAND FLOOR AREA HALT (STOP) DUST REMAIN GROUND NATIVE COUNTRY DWELL (LIVE, RESIDE) COUNTRY HUSBAND BACK END (OF TIME) SPINE GRASS DEW MARRIED WOMAN ROOSTER INSECT FOWL BIRD ANIMAL HEN SHORT BABY CORN FIELD THIN SAGO PALM GARDEN SMALL THIN (OF SHAPE OF OBJECT) CLAN NARROW FAMILY YOUNG CITIZEN FINE OR THIN SHALLOW THIN (SLIM) GIRL RELATIVES YOUNG MAN FRIEND PARENTS CHILD (DESCENDANT) YOUNG WOMAN BOY NEIGHBOUR CHILD (YOUNG HUMAN) SON SIBLING BROTHER DESCENDANTS OLDER SIBLING DAUGHTER ALONE FENCE ONLY FEW TOWER SOME ONE YARD OUTSIDE FORTRESS NEVER PLAIN PEOPLE VALLEY DOWN FIELD LOW PERSON YOUNGER SIBLING YOUNGER SISTER OLDER BROTHER YOUNGER BROTHER COUSIN SISTER OLDER SISTER NEPHEW DAMP FLOWER MANY SMOOTH WIDE FLAT BLOOD WET BELOW OR UNDER DOWN OR BELOW GREY BREAD DOUGH RAW VILLAGE GREEN CROWD SOFT AT ALL SLIP UNRIPE VEIN BLOOD VESSEL ALWAYS TENDON ROOF ROOT INSIDE OR GENTLE OLD WITH ENOUGH OLD (AGED) FORMER AND ROOM HOME TENT HUT GARDEN-HOUSE WEAK DENSE MEN'S HOUSE OLD MAN LAZY STILL (CONTINUING) TIRED AGAIN MORE READY OLD WOMAN SOMETIMES IN HOUSE OFTEN YELLOW RED AFTERWARDS BIG GOLD YOLK HOUR SALTY PINCH KNEEL AGE RIPE THICK FULL STRAIGHT BE LATE LIGHT (RADIATION) ABOVE WORK (ACTIVITY) PRODUCE MAKE DAY (NOT NIGHT) HEAVEN WORK (LABOUR) BUILD FAR AT THAT TIME LONG WHITE LENGTH THEN MOUNTAIN OR HILL SEASON HAVE PRESS GET PICK UP HEAD HOLD EARN DO OR MAKE WEATHER FATHER STEPFATHER UNCLE FATHER-IN-LAW (OF MAN) FATHER'S BROTHER MOTHER'S BROTHER STEPMOTHER AUNT BEGINNING BEGIN FIRST FATHER'S SISTER MOTHER-IN-LAW (OF WOMAN) MOTHER'S SISTER MOTHER MOTHER-IN-LAW (OF MAN) PARENTS-IN-LAW GRANDDAUGHTER SON-IN-LAW (OF WOMAN) FATHER-IN-LAW (OF WOMAN) SON-IN-LAW (OF MAN) DAUGHTER-IN-LAW (OF WOMAN) CHILD-IN-LAW SIBLING'S CHILD NIECE GRANDFATHER DAUGHTER-IN-LAW (OF MAN) IN FRONT OF FORWARD GRANDSON GRANDCHILD GRANDMOTHER ANCESTORS GRANDPARENTS THING STREET MANNER ROAD PIECE PORT PATH OR ROAD PATH RIB BONE BAIT THIGH BAY FLESH OR MEAT MEAT FOOTPRINT SIDE PART SLICE WALL (OF HOUSE) MIDDLE NAVEL SNOW LAST (FINAL) HAY HALF NEAR CHICKEN BULL SNAKE WORM CATTLE LIVESTOCK CALF OX COW WHICH WHITHER (WHERE TO) WINE HOW CIRCLE RING BALL BRACELET HOW MUCH HOW MANY BEEHIVE GRAVE CAVE BEARD RAIN (RAINING) SPRING OR WELL MOUSTACHE STREAM GLUE ALCOHOL (FERMENTED DRINK) BEE BEER HONEY WHO WASP MEAD WHAT WHY CANDY LUNCH ITEM WARE CUSTOM LAW MIDDAY PIT (POTHOLE) HOLE FURROW DITCH LAIR JUDGMENT COURT ADJUDICATE CONDEMN CONVICT ACCUSE BLAME ANNOUNCE PREACH EXPLAIN SAY ASK (REQUEST) THROW BUDGE (ONESELF) SHOOT EMBERS UGLY CHOP CUT DOWN COLD (OF WEATHER) FIREWOOD GRASP LEAD (GUIDE) DISTANCE LIE DOWN CARRY ON HEAD PERMIT PUSH MOLAR TOOTH FRONT TOOTH (INCISOR) RIDGEPOLE BEAK COAT TOWEL HELMET SHIRT HEADBAND HEADGEAR RAG VEIL SOON TOGETHER IMMEDIATELY NEST NOW BED TODAY INSTANTLY SUDDENLY RUG WITHOUT PONCHO BLANKET CLOAK MAT BEFORE BOLT (MOVE IN HASTE) ROAR (OF SEA) FAST DASH (OF VEHICLE) EARLY YESTERDAY HURRY AT FIRST EMPTY NO DRY ZERO NOTHING NOT RESULT IN BE BORN HAPPEN PASS SUCCEED BECOME BRAVE CLOTH POWERFUL DARE LOUD GRASS-SKIRT DRESS CLOTHES SKIRT RIPEN SOLID PIERCE HARD BEGET ROUGH REFUSE FRY DRESS UP DENY CALM MORNING PEACE BE SILENT QUIET SWELL TOMORROW HEALTHY EXPENSIVE HAPPY ROAST OR FRY STRONG BAKE PRICE BOIL (SOMETHING) PUT ON COOKED SLOW FAITHFUL RIGHT LAST (ENDURE) FOR A LONG TIME DAWN BEAUTIFUL GOOD COOK (SOMETHING) YES CORRECT (RIGHT) BOIL (OF LIQUID) DO PUT BRIGHT CLEAN LIGHT (COLOR) LAY (VERB) SHINE SEAT (SOMEBODY) INNOCENT FORBID PREPARE CERTAIN TRUTH TRUE DEAR PRECIOUS WARM HEAT CONCEIVE SEW LOOM PLAIT LIGHT (IGNITE) BURN (SOMETHING) PREVENT HOLY GOOD-LOOKING ARSON BEND CHANGE (BECOME DIFFERENT) BURNING TWIST DEBT CROOKED ROLL SPIN HEAVY HOT WEAVE DIFFICULT FEVER PLAIT OR BRAID OR WEAVE PREGNANT OWE TWINKLE CLEAR BEND (SOMETHING) MORTAR CRUSHER PESTLE BITTER MILL MONTH SKULL MEASURE TRY COME BACK TIME MOON COUNT JOIN SQUEEZE PILE UP CLOCK BUY DRAW MILK DAY (24 HOURS) BETRAY GUARD PROTECT PAY KNEE KEEP SELL SUN BILL HELP LIE (MISLEAD) TRADE OR BARTER DECEIT PERJURY RESCUE CURE FOLD SIEVE PRESERVE TRANSLATE TURN (SOMETHING) TURN WRAP HERD (SOMETHING) WAGES DEFEND CHANGE RETURN HOME TIE UP (TETHER) TURN AROUND HANG KNIT WEIGH HANG UP GIVE BACK CONNECT COVER BUTTON BUNCH KNOT SHUT BUNDLE TIE NOOSE GILL EAR EARLOBE THINK FOLLOW JEWEL BE ABLE OBEY SUMMER FEEL (TACTUALLY) REMEMBER SUSPECT BELIEVE GUESS RECOGNIZE (SOMEBODY) SOUR SWEET SUGAR CANE BRACKISH SUGAR TASTY CALCULATE IMITATE CITRUS FRUIT TASTE (SOMETHING) READ COME PRECIPICE SEE STONE OR ROCK APPROACH TOUCH ARRIVE YEAR MEET GRIND FRAGRANT ROTTEN SMELL (STINK) SMELL (PERCEIVE) STINKING SNIFF PUS FEEL UNDERSTAND HEAR THINK (BELIEVE) LISTEN MOVE (AFFECT EMOTIONALLY) KNOW (SOMETHING) NOTICE (SOMETHING) WATCH LEARN REEF STUDY LOOK FOR LOOK NASAL MUCUS (SNOT) SPLASH PITY HIDE (CONCEAL) SHELF FLY (MOVE THROUGH AIR) REGRET NOSTRIL THIEF BOARD SINK (DESCEND) DECREASE CHEEK NOSE BROKEN LOSE EMERGE (APPEAR) ANXIETY BAD LUCK GOOD LUCK OMEN WRONG SLAB FOREHEAD EYE BAD EVIL TABLE INJURE DANGER SURPRISED HARVEST BERRY FEAR (FRIGHT) NUT FAULT MISTAKE BECOME SICK SEED MISS (A TARGET) GUILTY SWELLING BRUISE BLISTER BOIL (OF SKIN) SCAR CHOKE ENTER ACHE SICK DISEASE PAIN DAMAGE (INJURY) SEVERE GRIEF SAUSAGE BEAD STOMACH INTESTINES CHAIN SPLEEN NECKLACE WOMB LIVER BELLY MEANING GHOST POSTCARD HEART LEGENDARY CREATURE SHADE DEMON BRAIN MEMORY FIGHT LETTER THOUGHT MIND BOOK COLLAR INTENTION SPIRIT PURSUE LONG HAIR SPRINGTIME HAIR (HEAD) THINK (REFLECT) DOUBT AUTUMN ORNAMENT HOPE ARMY QUARREL BEAT SOLDIER KNOCK BATTLE NOISE REST NAPE (OF NECK) THROAT NECK IDEA IF BECAUSE SLEEP FOREST DRIP (FALL IN GLOBULES) STICK TREE WALKING STICK PLANT (VEGETATION) LIE (REST) DRAG ASK (INQUIRE) DIVIDE URGE (SOMEONE) STING BRANCH CAMPFIRE BORROW SEPARATE TOOTH MOUTH CANDLE FALL ASLEEP DRIVE (CATTLE) MATCH DRIVE RAFTER BEAM DOORPOST DREAM (SOMETHING) POST MAST TUMBLE (FALL DOWN) WALK TREE TRUNK LAND (DESCEND) TEAR (SHRED) SAW GO OUT FALL TEAR (OF EYE) GO DOWN (DESCEND) BODY TREE STUMP SHOW CARVE SPOIL (SOMEBODY OR SOMETHING) BREAK (CLEAVE) PLANT (SOMETHING) DESTROY WALK (TAKE A WALK) CHIN BREAK (DESTROY OR GET DESTROYED) CUT PICK SPLIT LEAVE PULL CLUB WOOD MOVE (ONESELF) HIRE PRAISE MIX KNEAD WIPE SNEEZE BOAST SCRATCH CLEAN (SOMETHING) HOARFROST WORSHIP COUGH SWEEP RUB SCRAPE CARCASS DIE (FROM ACCIDENT) DIE BATHE SWIM DEAD FLOAT LOVE STAB SAIL PEEL SPREAD OUT CRY COMMON COLD (DISEASE) FROST CORPSE SHRIEK JUMP SHOUT DIG WINTER NAME STREAM (FLOW CONTINUOUSLY) PLOUGH CULTIVATE PLAY VISIBLE SEEM STRETCH SOW SEEDS RETREAT INVITE MUSIC RUN COLD HOLLOW OUT CHARCOAL TONGUE STOVE CONVERSATION SKIN DIVORCE OVEN EARWAX COOKHOUSE TIP (OF TONGUE) AIR HUNT BORE CALL BY NAME BREATH STEP (VERB) SONG ATTACK WASH PROUD SIN DEFENDANT CRIME CHIME (ACTION) EGG TESTICLES BARLEY FRUIT VEGETABLES GRAIN MAIZE RICE WHEAT RUDDER RYE PADDLE SWAY SWING (MOVEMENT) SWING (SOMETHING) SHAKE ROW FREEZE JOG (SOMETHING) OAT SHIVER RINSE RING (MAKE SOUND) MAKE NOISE SOUND (OF INSTRUMENT OR VOICE) TINKLE HOE SHOVEL SPADE FLOW DANCE FLEE CALL DAMAGE SAME FACE SIMILAR DISAPPEAR ESCAPE PRAY GAME BURY CAPE CHAIR MOVE STEAL GROAN HOWL COLD (CHILL) JAW DROWN SINK (DISAPPEAR IN WATER) SET (HEAVENLY BODIES) DIVE WOUND POUND TALK BREATHE PROMISE SPEAK WIND VOICE FUR PUBIC HAIR SOUND OR NOISE STRIKE OR BEAT BARK SCALE KILL HAMMER TONE (MUSIC) WOOL EXTINGUISH MURDER HIT SPEECH CHAT (WITH SOMEBODY) WORD STORM THRESH LEATHER LIKE NEED (NOUN) FELT SKIN (OF FRUIT) PAPER OATH WANT SWEAR KICK SNAIL DEATH PULL OFF (SKIN) SHELL FIREPLACE PEN HAIR (BODY) LANGUAGE CONVEY (A MESSAGE) TELL LEAF (LEAFLIKE OBJECT) FEATHER POUR FLAME GO SING BEESWAX HELL GATHER CARRY SEIZE CATCH TRAP (CATCH) WING FIRE CARRY ON SHOULDER CAST MOW BOSS FIND FIN ADMIT TEACH LEAF SAILCLOTH HAIR ANSWER SAY FOOT CIRCLE GRAIN Largest connected component in CLICS² Clusters inferred with the Infomap Community Detection algorithm List et al. (2018) 46 / 50
  109. 171.

    Jenseits von Sprachwandel Jenseits von Sprachwandel: Polysemiedaten CLICS: Database of

    Cross-Linguistic Colexifications http://clics.clld.org List et al. (2018) CARRY IN HAND CARRY UNDER ARM RULE ORDER SALT TAKE CHOOSE LEND SHARE BRING FORGET ACQUIT HAVE SEX HAND LIBERATE DIRTY GUEST ARM BETWEEN UPPER ARM MOLD TORCH OR LAMP OWN GAP (DISTANCE) DRIP (EMIT LIQUID) FINGERNAIL OR TOENAIL RIVER KISS RAIN (PRECIPITATION) WHEN SPOON SUCK ROUND LICK FINGERNAIL CLAW SOUP DRINK FORK PITCHFORK WATER SEA OPEN SMOKE (INHALE) LET GO OR SET FREE CAUSE DIRT FORKED BRANCH SEND LIP FORGIVE UNTIE ANCHOR EAT BITE BEVERAGE SWALLOW SAP URINE ANKLE FISHHOOK WHEEL WHERE LIFT CHIEFTAIN LOWER ARM CAUSE TO (LET) QUEEN GIVE ELBOW DONATE ELECTRICITY SKY STORM CLOUDS MUD SWAMP SMOKE (EXHAUST) FRESH SMOKE (EMIT SMOKE) STRANGER CEASE MOORLAND HOST GO UP (ASCEND) WEDDING CLIMB CLOUD PALM OF HAND FIVE MARRY RISE (MOVE UPWARDS) WRIST KING PRESIDENT FATHOM COLLARBONE RIDE SPACE (AVAILABLE) MASTER SHOULDER BROOM RAKE FLESH HOOK DRIBBLE SPIT TOE PAW OCEAN FINGER LAKE EDGE OBSCURE TOP NIGHT INCREASE WORLD UP DARKNESS BE GOD CALF OF LEG LEG SHIN FISH LOWER LEG WOMAN FEMALE (OF PERSON) FEMALE FEMALE (OF ANIMAL) LAGOON CORNER BORDER BESIDE FRINGE BOUNDARY WIFE COAST POINTED SHARP SHORE PLACE (POSITION) END (OF SPACE) EARTH (SOIL) BLACK STAND UP CHEW MEAL BREAKFAST HEEL FOOD DINNER (SUPPER) FOOT STAR SAND CLAY STAND SHOULDERBLADE CRAWL WAKE UP FOG FINISH DARK MALE ICE WAIST MARRIED MAN HIP DEEP LUNG FOAM REMAINS BLUE WAIT (FOR) LIFE LATE BE ALIVE AFTER TOWN BEHIND ASH FLOUR STATE (POLITICS) NEW UPPER BACK BOTTOM PASTURE THATCH BUTTOCKS MAN MALE (OF ANIMAL) MALE (OF PERSON) SIT DOWN TALL CROUCH EVENING AFTERNOON HIGH WEST GROW MAINLAND SIT LAND FLOOR AREA HALT (STOP) DUST REMAIN GROUND NATIVE COUNTRY DWELL (LIVE, RESIDE) COUNTRY HUSBAND BACK END (OF TIME) SPINE GRASS DEW MARRIED WOMAN ROOSTER INSECT FOWL BIRD ANIMAL HEN SHORT BABY CORN FIELD THIN SAGO PALM GARDEN SMALL THIN (OF SHAPE OF OBJECT) CLAN NARROW FAMILY YOUNG CITIZEN FINE OR THIN SHALLOW THIN (SLIM) GIRL RELATIVES YOUNG MAN FRIEND PARENTS CHILD (DESCENDANT) YOUNG WOMAN BOY NEIGHBOUR CHILD (YOUNG HUMAN) SON SIBLING BROTHER DESCENDANTS OLDER SIBLING DAUGHTER ALONE FENCE ONLY FEW TOWER SOME ONE YARD OUTSIDE FORTRESS NEVER PLAIN PEOPLE VALLEY DOWN FIELD LOW PERSON YOUNGER SIBLING YOUNGER SISTER OLDER BROTHER YOUNGER BROTHER COUSIN SISTER OLDER SISTER NEPHEW DAMP FLOWER MANY SMOOTH WIDE FLAT BLOOD WET BELOW OR UNDER DOWN OR BELOW GREY BREAD DOUGH RAW VILLAGE GREEN CROWD SOFT AT ALL SLIP UNRIPE VEIN BLOOD VESSEL ALWAYS TENDON ROOF ROOT INSIDE OR GENTLE OLD WITH ENOUGH OLD (AGED) FORMER AND ROOM HOME TENT HUT GARDEN-HOUSE WEAK DENSE MEN'S HOUSE OLD MAN LAZY STILL (CONTINUING) TIRED AGAIN MORE READY OLD WOMAN SOMETIMES IN HOUSE OFTEN YELLOW RED AFTERWARDS BIG GOLD YOLK HOUR SALTY PINCH KNEEL AGE RIPE THICK FULL STRAIGHT BE LATE LIGHT (RADIATION) ABOVE WORK (ACTIVITY) PRODUCE MAKE DAY (NOT NIGHT) HEAVEN WORK (LABOUR) BUILD FAR AT THAT TIME LONG WHITE LENGTH THEN MOUNTAIN OR HILL SEASON HAVE PRESS GET PICK UP HEAD HOLD EARN DO OR MAKE WEATHER FATHER STEPFATHER UNCLE FATHER-IN-LAW (OF MAN) FATHER'S BROTHER MOTHER'S BROTHER STEPMOTHER AUNT BEGINNING BEGIN FIRST FATHER'S SISTER MOTHER-IN-LAW (OF WOMAN) MOTHER'S SISTER MOTHER MOTHER-IN-LAW (OF MAN) PARENTS-IN-LAW GRANDDAUGHTER SON-IN-LAW (OF WOMAN) FATHER-IN-LAW (OF WOMAN) SON-IN-LAW (OF MAN) DAUGHTER-IN-LAW (OF WOMAN) CHILD-IN-LAW SIBLING'S CHILD NIECE GRANDFATHER DAUGHTER-IN-LAW (OF MAN) IN FRONT OF FORWARD GRANDSON GRANDCHILD GRANDMOTHER ANCESTORS GRANDPARENTS THING STREET MANNER ROAD PIECE PORT PATH OR ROAD PATH RIB BONE BAIT THIGH BAY FLESH OR MEAT MEAT FOOTPRINT SIDE PART SLICE WALL (OF HOUSE) MIDDLE NAVEL SNOW LAST (FINAL) HAY HALF NEAR CHICKEN BULL SNAKE WORM CATTLE LIVESTOCK CALF OX COW WHICH WHITHER (WHERE TO) WINE HOW CIRCLE RING BALL BRACELET HOW MUCH HOW MANY BEEHIVE GRAVE CAVE BEARD RAIN (RAINING) SPRING OR WELL MOUSTACHE STREAM GLUE ALCOHOL (FERMENTED DRINK) BEE BEER HONEY WHO WASP MEAD WHAT WHY CANDY LUNCH ITEM WARE CUSTOM LAW MIDDAY PIT (POTHOLE) HOLE FURROW DITCH LAIR JUDGMENT COURT ADJUDICATE CONDEMN CONVICT ACCUSE BLAME ANNOUNCE PREACH EXPLAIN SAY ASK (REQUEST) THROW BUDGE (ONESELF) SHOOT EMBERS UGLY CHOP CUT DOWN COLD (OF WEATHER) FIREWOOD GRASP LEAD (GUIDE) DISTANCE LIE DOWN CARRY ON HEAD PERMIT PUSH MOLAR TOOTH FRONT TOOTH (INCISOR) RIDGEPOLE BEAK COAT TOWEL HELMET SHIRT HEADBAND HEADGEAR RAG VEIL SOON TOGETHER IMMEDIATELY NEST NOW BED TODAY INSTANTLY SUDDENLY RUG WITHOUT PONCHO BLANKET CLOAK MAT BEFORE BOLT (MOVE IN HASTE) ROAR (OF SEA) FAST DASH (OF VEHICLE) EARLY YESTERDAY HURRY AT FIRST EMPTY NO DRY ZERO NOTHING NOT RESULT IN BE BORN HAPPEN PASS SUCCEED BECOME BRAVE CLOTH POWERFUL DARE LOUD GRASS-SKIRT DRESS CLOTHES SKIRT RIPEN SOLID PIERCE HARD BEGET ROUGH REFUSE FRY DRESS UP DENY CALM MORNING PEACE BE SILENT QUIET SWELL TOMORROW HEALTHY EXPENSIVE HAPPY ROAST OR FRY STRONG BAKE PRICE BOIL (SOMETHING) PUT ON COOKED SLOW FAITHFUL RIGHT LAST (ENDURE) FOR A LONG TIME DAWN BEAUTIFUL GOOD COOK (SOMETHING) YES CORRECT (RIGHT) BOIL (OF LIQUID) DO PUT BRIGHT CLEAN LIGHT (COLOR) LAY (VERB) SHINE SEAT (SOMEBODY) INNOCENT FORBID PREPARE CERTAIN TRUTH TRUE DEAR PRECIOUS WARM HEAT CONCEIVE SEW LOOM PLAIT LIGHT (IGNITE) BURN (SOMETHING) PREVENT HOLY GOOD-LOOKING ARSON BEND CHANGE (BECOME DIFFERENT) BURNING TWIST DEBT CROOKED ROLL SPIN HEAVY HOT WEAVE DIFFICULT FEVER PLAIT OR BRAID OR WEAVE PREGNANT OWE TWINKLE CLEAR BEND (SOMETHING) MORTAR CRUSHER PESTLE BITTER MILL MONTH SKULL MEASURE TRY COME BACK TIME MOON COUNT JOIN SQUEEZE PILE UP CLOCK BUY DRAW MILK DAY (24 HOURS) BETRAY GUARD PROTECT PAY KNEE KEEP SELL SUN BILL HELP LIE (MISLEAD) TRADE OR BARTER DECEIT PERJURY RESCUE CURE FOLD SIEVE PRESERVE TRANSLATE TURN (SOMETHING) TURN WRAP HERD (SOMETHING) WAGES DEFEND CHANGE RETURN HOME TIE UP (TETHER) TURN AROUND HANG KNIT WEIGH HANG UP GIVE BACK CONNECT COVER BUTTON BUNCH KNOT SHUT BUNDLE TIE NOOSE GILL EAR EARLOBE THINK FOLLOW JEWEL BE ABLE OBEY SUMMER FEEL (TACTUALLY) REMEMBER SUSPECT BELIEVE GUESS RECOGNIZE (SOMEBODY) SOUR SWEET SUGAR CANE BRACKISH SUGAR TASTY CALCULATE IMITATE CITRUS FRUIT TASTE (SOMETHING) READ COME PRECIPICE SEE STONE OR ROCK APPROACH TOUCH ARRIVE YEAR MEET GRIND FRAGRANT ROTTEN SMELL (STINK) SMELL (PERCEIVE) STINKING SNIFF PUS FEEL UNDERSTAND HEAR THINK (BELIEVE) LISTEN MOVE (AFFECT EMOTIONALLY) KNOW (SOMETHING) NOTICE (SOMETHING) WATCH LEARN REEF STUDY LOOK FOR LOOK NASAL MUCUS (SNOT) SPLASH PITY HIDE (CONCEAL) SHELF FLY (MOVE THROUGH AIR) REGRET NOSTRIL THIEF BOARD SINK (DESCEND) DECREASE CHEEK NOSE BROKEN LOSE EMERGE (APPEAR) ANXIETY BAD LUCK GOOD LUCK OMEN WRONG SLAB FOREHEAD EYE BAD EVIL TABLE INJURE DANGER SURPRISED HARVEST BERRY FEAR (FRIGHT) NUT FAULT MISTAKE BECOME SICK SEED MISS (A TARGET) GUILTY SWELLING BRUISE BLISTER BOIL (OF SKIN) SCAR CHOKE ENTER ACHE SICK DISEASE PAIN DAMAGE (INJURY) SEVERE GRIEF SAUSAGE BEAD STOMACH INTESTINES CHAIN SPLEEN NECKLACE WOMB LIVER BELLY MEANING GHOST POSTCARD HEART LEGENDARY CREATURE SHADE DEMON BRAIN MEMORY FIGHT LETTER THOUGHT MIND BOOK COLLAR INTENTION SPIRIT PURSUE LONG HAIR SPRINGTIME HAIR (HEAD) THINK (REFLECT) DOUBT AUTUMN ORNAMENT HOPE ARMY QUARREL BEAT SOLDIER KNOCK BATTLE NOISE REST NAPE (OF NECK) THROAT NECK IDEA IF BECAUSE SLEEP FOREST DRIP (FALL IN GLOBULES) STICK TREE WALKING STICK PLANT (VEGETATION) LIE (REST) DRAG ASK (INQUIRE) DIVIDE URGE (SOMEONE) STING BRANCH CAMPFIRE BORROW SEPARATE TOOTH MOUTH CANDLE FALL ASLEEP DRIVE (CATTLE) MATCH DRIVE RAFTER BEAM DOORPOST DREAM (SOMETHING) POST MAST TUMBLE (FALL DOWN) WALK TREE TRUNK LAND (DESCEND) TEAR (SHRED) SAW GO OUT FALL TEAR (OF EYE) GO DOWN (DESCEND) BODY TREE STUMP SHOW CARVE SPOIL (SOMEBODY OR SOMETHING) BREAK (CLEAVE) PLANT (SOMETHING) DESTROY WALK (TAKE A WALK) CHIN BREAK (DESTROY OR GET DESTROYED) CUT PICK SPLIT LEAVE PULL CLUB WOOD MOVE (ONESELF) HIRE PRAISE MIX KNEAD WIPE SNEEZE BOAST SCRATCH CLEAN (SOMETHING) HOARFROST WORSHIP COUGH SWEEP RUB SCRAPE CARCASS DIE (FROM ACCIDENT) DIE BATHE SWIM DEAD FLOAT LOVE STAB SAIL PEEL SPREAD OUT CRY COMMON COLD (DISEASE) FROST CORPSE SHRIEK JUMP SHOUT DIG WINTER NAME STREAM (FLOW CONTINUOUSLY) PLOUGH CULTIVATE PLAY VISIBLE SEEM STRETCH SOW SEEDS RETREAT INVITE MUSIC RUN COLD HOLLOW OUT CHARCOAL TONGUE STOVE CONVERSATION SKIN DIVORCE OVEN EARWAX COOKHOUSE TIP (OF TONGUE) AIR HUNT BORE CALL BY NAME BREATH STEP (VERB) SONG ATTACK WASH PROUD SIN DEFENDANT CRIME CHIME (ACTION) EGG TESTICLES BARLEY FRUIT VEGETABLES GRAIN MAIZE RICE WHEAT RUDDER RYE PADDLE SWAY SWING (MOVEMENT) SWING (SOMETHING) SHAKE ROW FREEZE JOG (SOMETHING) OAT SHIVER RINSE RING (MAKE SOUND) MAKE NOISE SOUND (OF INSTRUMENT OR VOICE) TINKLE HOE SHOVEL SPADE FLOW DANCE FLEE CALL DAMAGE SAME FACE SIMILAR DISAPPEAR ESCAPE PRAY GAME BURY CAPE CHAIR MOVE STEAL GROAN HOWL COLD (CHILL) JAW DROWN SINK (DISAPPEAR IN WATER) SET (HEAVENLY BODIES) DIVE WOUND POUND TALK BREATHE PROMISE SPEAK WIND VOICE FUR PUBIC HAIR SOUND OR NOISE STRIKE OR BEAT BARK SCALE KILL HAMMER TONE (MUSIC) WOOL EXTINGUISH MURDER HIT SPEECH CHAT (WITH SOMEBODY) WORD STORM THRESH LEATHER LIKE NEED (NOUN) FELT SKIN (OF FRUIT) PAPER OATH WANT SWEAR KICK SNAIL DEATH PULL OFF (SKIN) SHELL FIREPLACE PEN HAIR (BODY) LANGUAGE CONVEY (A MESSAGE) TELL LEAF (LEAFLIKE OBJECT) FEATHER POUR FLAME GO SING BEESWAX HELL GATHER CARRY SEIZE CATCH TRAP (CATCH) WING FIRE CARRY ON SHOULDER CAST MOW BOSS FIND FIN ADMIT TEACH LEAF SAILCLOTH HAIR ANSWER SAY FOOT CIRCLE GRAIN Largest connected component in CLICS² Clusters inferred with the Infomap Community Detection algorithm List et al. (u. rev.) TONGUE TELL ANNOUNCE TALK ADMIT CHAT (WITH SOMEBODY) SAY WORD ANSWER LANGUAGE VOICE SOUND OR NOISE NOISE PREACH SPEECH TONE (MUSIC) EXPLAIN CONVERSATION CONVEY (A MESSAGE) SPEAK 46 / 50
  110. 172.

    Jenseits von Sprachwandel Jenseits von Sprachwandel: Polysemiedaten TOE ANKLE ROUND

    RING FOOT CIRCLE WHEEL LEG BALL FOOTPRINT HEEL CLICS: Database of Cross-Linguistic Colexifications http://clics.clld.org List et al. (2018) 46 / 50
  111. 180.

    Ausblick Ausblick Wo wird die vergleichende Sprachwissenschaft in fünf Jahren

    sein? Wir werden viel mehr Daten haben, darunter mehr leicht vergleichbare Daten. 49 / 50
  112. 181.

    Ausblick Ausblick Wo wird die vergleichende Sprachwissenschaft in fünf Jahren

    sein? Wir werden viel mehr Daten haben, darunter mehr leicht vergleichbare Daten. Die Verwendung von Computern wird noch ein Stück normaler geworden sein für Linguistinnen und Linguisten. 49 / 50
  113. 182.

    Ausblick Ausblick Wo wird die vergleichende Sprachwissenschaft in fünf Jahren

    sein? Wir werden viel mehr Daten haben, darunter mehr leicht vergleichbare Daten. Die Verwendung von Computern wird noch ein Stück normaler geworden sein für Linguistinnen und Linguisten. Auch wenn wir die ganz großen Fragen (Ursache des Sprachwandels, Ursprung der Sprache, automatische Erkennung von Fakenews) nicht lösen können, so werden wir doch mehr wissen, als heute. 49 / 50
  114. 183.

    Danke fürs Zuhören! • Name: Dr. Johann-Mattis List • Forschungsprojekt:

    Computer-Assisted Language Comparison. Reconciling Computational and Classical Approaches in Historical Linguistics • Webseite: http://calc.digling.org • Projektdauer: April 2017-März 2022 • Institut: Max-Planck-Institute für Menschheits- geschichte, Jena LC CA COMPUTA- TIONAL HISTORICAL LINGUISTICS COMPA- RATIVE METHOD 50 / 50