Sprachen als Schlüssel zur Vergangenheit

Sprachen als Schlüssel zur Vergangenheit

Talk held at the "Salon Sophie Charlotte" (2018/01/20, Berlin-Brandenburgische Akademie der Wissenschaften, Berlin)

E01961dd2fbd219a30044ffe27c9fb70?s=128

Johann-Mattis List

January 20, 2018
Tweet

Transcript

  1. Sprachen als Schlüssel zur Vergangenheit Johann-Mattis List Forschungsgruppe «Computergestützter Sprachvergleich»

    Abteilung für linguistische und kulturelle Evolution Max-Planck-Institut für Menschheitsgeschichte Jena, Deutschland 2018-01-20 very long title P(A|B)=P(B|A)... 1 / 48
  2. 2 / 48

  3. A A G T C T A G G T

    T A C C C G T A T Time (s) 0.4 2 -0.5396 0.3128 0 Do languages grow on trees? Spure� der Vergangenhei� 2 / 48
  4. A A G T C T A G G T

    T A C C C G T A T Time (s) 0.4 2 -0.5396 0.3128 0 Do languages grow on trees? Spure� der Vergangenhei� 2 / 48
  5. A A G T C T A G G T

    T A C C C G T A T Spure� der Vergangenhei� Time (s) 0.4 2 -0.5396 0.3128 0 Do languages grow on trees? 2 / 48
  6. Mei� Herr, bitt� auf keine� Fal� di� vergleichend� Sprachwissenscha�, di�

    Sprachwissenscha� führ� zu� Schlimmste�! 2 / 48
  7. Inhalt 1 Sprachwandel Sprachwandel im Alltag Sprachwandel als Sprachverfall Sprachwandel

    in der Forschung 2 Klassischer Sprachvergleich Die komparative Methode Die phylogenetische Rekonstruktion Erkenntnisse 3 Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Grundlegendes Erkenntnisse 4 Jenseits von Sprachwandel 5 Ausblick 3 / 48
  8. Sprachwandel 4 / 48

  9. "Die Sprachen [ändern] sich [...] so lange sie leben.." (August

    Schleicher 1863) walkman Indogermanisch Germanisch Altenglisch Englisch p f f f ə a æ ɑː t d d ð eː eː e ə r r r r iPod Sprachwandel 4 / 48
  10. "Die Sprachen [ändern] sich [...] so lange sie leben.." (August

    Schleicher 1863) walkman Indogermanisch Germanisch Altenglisch Englisch p f f f ə a æ ɑː t d d ð eː eː e ə r r r r iPod Sprachwandel 4 / 48
  11. "Die Sprachen [ändern] sich [...] so lange sie leben.." (August

    Schleicher 1863) walkman Indogermanisch Germanisch Altenglisch Englisch p f f f ə a æ ɑː t d d ð eː eː e ə r r r r iPod Sprachwandel 4 / 48
  12. "Die Sprachen [ändern] sich [...] so lange sie leben.." (August

    Schleicher 1863) walkman Indogermanisch Germanisch Altenglisch Englisch p f f f ə a æ ɑː t d d ð eː eː e ə r r r r iPod Sprachwandel 4 / 48
  13. Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Wörter 5 /

    48
  14. Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Wörter 5 /

    48
  15. Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Wörter 5 /

    48
  16. Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Wortgeschichten 6 /

    48
  17. Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Wortgeschichten Komm� «pr��»

    eigentlic� vo� «Pr�tituiert�»? 6 / 48
  18. Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Küchenetymologien 7 /

    48
  19. Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Küchenetymologien Konservativ kommt

    nicht von Konserve! Angela Merkel (10. April 2000) 7 / 48
  20. Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Küchenetymologien konservativ Wortart

    Adjektiv Häufigkeit moderat Bedeutung «am Hergebrachten, Her- kömmlichen, Überlieferten hängend, festhaltend» Synonyme «bewahrend», «erhaltend», «ohne Operation» Aussprache ˈkɔnzɛrvatiːf Ursprung Englisch conservative 8 / 48
  21. Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Küchenetymologien Englisch conservative

    «antiquiert» Mittellatin conservativus «beschützend» Latein conservare «bewahren» Urromanisch *serwo- «Hirte» Urindogermanisch *ser-u-o «Beschützer» Adamische Sprache ??? «?» 8 / 48
  22. Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Küchenetymologien Konserve Wortart

    Substantiv Häufigkeit moderat Bedeutung «in einer [...] Büchse oder in einem Glas aufbewahrtes Nah- rungsmittel [...]» Synonyme «bewahrend», «erhaltend», «ohne Operation» Aussprache kɔnzˈɛrvə Ursprung Mittellatein conserva 8 / 48
  23. Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Küchenetymologien Mittellatein conserva

    «antiquiert» Mittellatein conserva «Eingelegtes» Latein conservare «bewahren» Urromanisch *serwo- «Hirte» Urindogermanisch *ser-u-o «Beschützer» Adamische Sprache ??? «?» 8 / 48
  24. Sprachwandel Sprachwandel im Alltag Sprachwandel im Alltag: Küchenetymologien Deutsch konservativ

    «antiquiert» Deutsch konservativ «antiquiert» Latein conservare «bewahren» Latein conservare «shepherd» Deutsch Konserve «Nahrungsmittelbüchse» Latein conservare «bewahren» 8 / 48
  25. Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall Poeten der Tángzeit

    in China (618⚶906 n. Chr.) 9 / 48
  26. Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall Poeten der Tángzeit

    in China (618⚶906 n. Chr.) Philosophen im alten Griechenland (ab 400 v. Chr.) 9 / 48
  27. Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall Poeten der Tángzeit

    in China (618⚶906 n. Chr.) Philosophen im alten Griechenland (ab 400 v. Chr.) Redner im alten Rom (ab 100 v. Chr.) 9 / 48
  28. Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall Poeten der Tángzeit

    in China (618⚶906 n. Chr.) Philosophen im alten Griechenland (ab 400 v. Chr.) Redner im alten Rom (ab 100 v. Chr.) Moderne Sprachpfleger wie B. Sick (2004) 9 / 48
  29. Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall: Macht das Sinn?

    10 / 48
  30. Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall: Macht das Sinn?

    machen ← Indogermanisch *mag- «kneten» 10 / 48
  31. Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall: Macht das Sinn?

    machen ← Indogermanisch *mag- «kneten» 10 / 48
  32. Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall: Macht das Sinn?

    machen ← Indogermanisch *mag- «kneten» engl. to make = dt. machen 10 / 48
  33. Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall: Fallverlust Ursprünglich: trotz

    + Dativ seit ca. 1800: trotz + Genitiv und trotz + Dativ 11 / 48
  34. Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall: Fallverlust Ursprünglich: trotz

    + Dativ seit ca. 1800: trotz + Genitiv und trotz + Dativ 11 / 48
  35. Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall: Fallverlust Ursprünglich: trotz

    + Dativ seit ca. 1800: trotz + Genitiv und trotz + Dativ 11 / 48
  36. Sprachwandel Sprachwandel als Sprachverfall Sprachwandel als Sprachverfall: Fallverlust Trotz dem

    Dativ hat der Genitiv noch eine Chance! Ursprünglich: trotz + Dativ seit ca. 1800: trotz + Genitiv und trotz + Dativ 11 / 48
  37. Sprachwandel Sprachwandel in der Forschung Sprachwandel in der Forschung Sprachwandel

    ist nicht Sprachverfall. 12 / 48
  38. Sprachwandel Sprachwandel in der Forschung Sprachwandel in der Forschung Sprachwandel

    ist nicht Sprachverfall. Sprachwandel ist allgegenwärtig und unvermeidbar. 12 / 48
  39. Sprachwandel Sprachwandel in der Forschung Sprachwandel in der Forschung Sprachwandel

    ist nicht Sprachverfall. Sprachwandel ist allgegenwärtig und unvermeidbar. Sprachwandel folgt in Teilen universellen Tendenzen und Trends. 12 / 48
  40. Sprachwandel Sprachwandel in der Forschung Sprachwandel in der Forschung Sprachwandel

    ist nicht Sprachverfall. Sprachwandel ist allgegenwärtig und unvermeidbar. Sprachwandel folgt in Teilen universellen Tendenzen und Trends. Sprachwandel verläuft in Teilen systematisch. 12 / 48
  41. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Pfanne Pfund

    Pfau Apfel Hopfen Fanne Fund Fau Apfel Hopfen pan pound peacock apple hop 13 / 48
  42. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Pfanne Pfund

    Pfau Apfel Hopfen Fanne Fund Fau Apfel Hopfen pan pound peacock apple hop 13 / 48
  43. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Pfanne Pfund

    Pfau Apfel Hopfen Fanne Fund Fau Apfel Hopfen pan pound peacock apple hops 13 / 48
  44. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Pfanne Pfund

    Pfau Apfel Hopfen Fanne Fund Fau Apfel Hopfen pan pound peacock apple hops p → pf → f 13 / 48
  45. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Jacob Grimm

    Rasmus Rask Undersøgelse om det gamle Nordiske Sprogs Oprindelse 1818 Deutsche Grammatik (Ausgabe II) 1822 Icelandic Sanskrit Old Greek Latin 13 / 48
  46. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Icelandic Old

    Indian Old Greek Latin Sanskrit Jacob Grimm Rasmus Rask Undersøgelse om det gamle Nordiske Sprogs Oprindelse 1818 Deutsche Grammatik (Ausgabe II) 1822 13 / 48
  47. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Icelandic Old

    Indian Old Greek Latin Sanskrit Indo-European Method for Language Comparison • intensive language comparison • identify regularly recurring similaritities → prove language relationship → reconstruct development of language families Jacob Grimm Rasmus Rask Undersøgelse om det gamle Nordiske Sprogs Oprindelse 1818 Deutsche Grammatik (Ausgabe II) 1822 13 / 48
  48. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Old Indian

    Old Greek Latin pe d- πο d- pā da "Fuß" Icelandic fó tur fótur ped- ποd- pāda 13 / 48
  49. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Old Indian

    Old Greek Latin "Fuß" Icelandic fótur ped- ποd- pāda pāda fótur pet- ποd- ótur ed- οd- āda Icelandic Latin Old Greek Old Indian f p π p itar- f p π p aðir ater atήr 13 / 48
  50. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Old Indian

    Old Greek Latin Icelandic faðir pater πatήr pitar- "Vater" faðir pater πatήr pitar- ótur ed- οd- āda Icelandic Latin Old Greek Old Indian f p π p itar- f p π p aðir ater atήr 13 / 48
  51. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel Old Indian

    Old Greek Latin Icelandic faðir pater πatήr pitar- "Vater" ótur ed- οd- āda Icelandic Latin Old Greek Old Indian f p π p itar- f p π p aðir ater atήr 13 / 48
  52. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel: Lautgesetze Aller

    lautwandel, soweit er mechanisch vor sich geht, vollzieht sich nach ausnahmslosen gesetzen, d.h. die richtung der lautbewegung ist bei allen angehörigen einer sprachgenossenschaft, ausser dem Fall, dass dialektspaltung eintritt, stets dieselbe, und alle wörter, in denen der der lautbewegung unterworfene laut unter gleichen verhältnissen erscheint, werden ohne ausnahme von der änderung ergriffen. (Osthoff und Brugmann 1878: XIII) 14 / 48
  53. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel: Wandel des

    Alphabets 15 / 48
  54. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel: Wandel des

    Alphabets Was ist das für ein Buchstabe? Das ist ein P. 15 / 48
  55. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel: Wandel des

    Alphabets Was ist das für ein Buchstabe? Das ist ein P. Ich püsse euch alle, ganz besonders Averell, meinen Pleinen. Das reicht! 15 / 48
  56. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel: Wandel des

    Alphabets Was ist das für ein Buchstabe? Das ist ein P. Ich püsse euch alle, ganz besonders Averell, meinen Pleinen. Das reicht! Aber wohin gehen wir, wenn man uns wieder einfängt? Plappe Pleiner! 15 / 48
  57. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel: Wandel des

    Alphabets Was ist das für ein Buchstabe? Das ist ein P. Ich püsse euch alle, ganz besonders Averell, meinen Pleinen. Das reicht! Aber wohin gehen wir, wenn man uns wieder einfängt? Plappe Pleiner! Liebe Kinder, heute habe ich Lucky Luke getroffen. Ich küsse euch, ganz besonders Averell, meinen Kleinen! Eure Ma Dalton 15 / 48
  58. Sprachwandel Sprachwandel in der Forschung Lautwandel als Systemwandel: Wandel des

    Alphabets Was ist das für ein Buchstabe? Das ist ein P. Ich püsse euch alle, ganz besonders Averell, meinen Pleinen. Das reicht! Aber wohin gehen wir, wenn man uns wieder einfängt? Plappe Pleiner! Liebe Pinder, heute habe ich Lucpy Lupe getroffen. Ich püsse euch, ganz besonders Averell, meinen Pleinen! Eure Ma Dalton 15 / 48
  59. Klassischer Sprachvergleich 16 / 48

  60. [Der historische Sprachvergleich] hat es mit den trockensten Einzelthatsachen zu

    thun [...]. Was sonst die Wissenschaft von den Sprachen [...] zu einer der lebensvollsten macht, das tritt hier zunächst zurück. [...] Der Sprachhistoriker steht draußen vor seinem Gegenstande: hier der Anatom, da der Cadaver. Georg von der Gabelentz (1891) Klassischer Sprachvergleich 16 / 48
  61. [Der historische Sprachvergleich] hat es mit den trockensten Einzelthatsachen zu

    thun [...]. Was sonst die Wissenschaft von den Sprachen [...] zu einer der lebensvollsten macht, das tritt hier zunächst zurück. [...] Der Sprachhistoriker steht draußen vor seinem Gegenstande: hier der Anatom, da der Cadaver. Georg von der Gabelentz (1891) Klassischer Sprachvergleich 16 / 48
  62. [Der historische Sprachvergleich] hat es mit den trockensten Einzelthatsachen zu

    thun [...]. Was sonst die Wissenschaft von den Sprachen [...] zu einer der lebensvollsten macht, das tritt hier zunächst zurück. [...] Der Sprachhistoriker steht draußen vor seinem Gegenstande: hier der Anatom, da der Cadaver. Georg von der Gabelentz (1891) Klassischer Sprachvergleich 16 / 48
  63. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode 17 /

    48
  64. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode Offiziell: 17

    / 48
  65. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode Offiziell: Die

    Kernmethode des historischen Sprachvergleichs. 17 / 48
  66. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode Offiziell: Die

    Kernmethode des historischen Sprachvergleichs. Das unantastbare Fundament, auf dem die historische Linguistik steht. 17 / 48
  67. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode Offiziell: Die

    Kernmethode des historischen Sprachvergleichs. Das unantastbare Fundament, auf dem die historische Linguistik steht. Tatsächlich: 17 / 48
  68. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode Offiziell: Die

    Kernmethode des historischen Sprachvergleichs. Das unantastbare Fundament, auf dem die historische Linguistik steht. Tatsächlich: Ein Oberbegriff für ein Sammelsurium an verschiedenen kaum standardisierten Techniken, die beständig weiterentwickelt werden. 17 / 48
  69. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode Offiziell: Die

    Kernmethode des historischen Sprachvergleichs. Das unantastbare Fundament, auf dem die historische Linguistik steht. Tatsächlich: Ein Oberbegriff für ein Sammelsurium an verschiedenen kaum standardisierten Techniken, die beständig weiterentwickelt werden. Besser verstanden als ein Coverterm für alle Methoden des historischen Sprachvergleichs. 17 / 48
  70. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Kognaten und

    Korrespondenzen Nase Nass Muse muss singen 18 / 48
  71. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Kognaten und

    Korrespondenzen Nase Nass Muse muss singen m → b n → d ng → g ss → f s → w 18 / 48
  72. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Kognaten und

    Korrespondenzen Nase Nass Muse muss singen Dase Dass Buse buss sigen Nawe Naf Muwe muf wingen 18 / 48
  73. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Kognaten und

    Korrespondenzen *Nase *Nass *Muse *muss *singen Dase Dass Buse buss sigen Nawe Naf Muwe muf wingen 18 / 48
  74. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... irreguläre Korrespondenz! 19 / 48
  75. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... irreguläre Korrespondenz! 19 / 48
  76. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... 19 / 48
  77. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... 19 / 48
  78. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... 19 / 48
  79. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... 19 / 48
  80. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... 19 / 48
  81. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Englisch und

    Deutsch Kognatenliste Alinierung Korrespondenzliste Deutsch dünn d ʏ n DEU ENG Frequ. d θ 3 x d d 1 x n n 2 x m m 1 x ŋ ŋ 1 x Englisch thin θ ɪ n Deutsch Ding d ɪ ŋ English thing θ ɪ ŋ Deutsch dumm d ʊ m Englisch dumb d ʌ m Deutsch Dorn d ɔɐ n Englisch thorn θ ɔː n ... ... ... irreguläre Korrespondenz! 19 / 48
  82. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Fazit 20

    / 48
  83. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Fazit Dank

    der Systematizität des Sprachwandels können wir im Rahmen des historischen Sprachvergleichs relativ sicher verwandte (kognate) Wörter ermitteln. 20 / 48
  84. Klassischer Sprachvergleich Die komparative Methode Die komparative Methode: Fazit Dank

    der Systematizität des Sprachwandels können wir im Rahmen des historischen Sprachvergleichs relativ sicher verwandte (kognate) Wörter ermitteln. Obwohl das Verfahren zum Ermitteln von Lautkorrespondenzen und kognaten Wörtern sehr formal gefasst und beschrieben werden kann, wird es vorwiegend manuell ausgeführt. 20 / 48
  85. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion Die phylogenetische Rekonstruktion 21 /

    48
  86. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion Die phylogenetische Rekonstruktion Unter phylogenetischer

    Rekonstruktion verstehen wir den Versuch, die Entwicklung einer Sprachfamilie in Form von Stammbäumen darzustellen. 21 / 48
  87. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion Die phylogenetische Rekonstruktion Unter phylogenetischer

    Rekonstruktion verstehen wir den Versuch, die Entwicklung einer Sprachfamilie in Form von Stammbäumen darzustellen. Die klassische phylogenetische Rekonstruktion in der Linguistik ist der Kladistik sehr ähnlich, wurde aber viel früher entwickelt. 21 / 48
  88. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion Die phylogenetische Rekonstruktion Unter phylogenetischer

    Rekonstruktion verstehen wir den Versuch, die Entwicklung einer Sprachfamilie in Form von Stammbäumen darzustellen. Die klassische phylogenetische Rekonstruktion in der Linguistik ist der Kladistik sehr ähnlich, wurde aber viel früher entwickelt. Leider sind die Kriterien für die Verfahren kaum formalisiert und werden auch selten transparent angewendet. 21 / 48
  89. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion Die phylogenetische Rekonstruktion 1700 1800

    1750 1850 Stiernhielm's Lingua Nova 1671 Gallet's Arbre ca. 1800 Darwin's Origins 1859 De Buffon's Table 1755 Schleicher's Stammbaum 1853 Darwin's Tree Sketch 1837 Lamarck's Tableaux 1809 Čelakovský's Rodový Kmen 1853 Rühling's Tabula 1774 Hicke's Affinitas 1689 Schottel's Tabelle 1663 List et al. (2016) 22 / 48
  90. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion Die phylogenetische Rekonstruktion 1700 1800

    1750 1850 Stiernhielm's Lingua Nova 1671 Gallet's Arbre ca. 1800 Darwin's Origins 1859 De Buffon's Table 1755 Schleicher's Stammbaum 1853 Darwin's Tree Sketch 1837 Lamarck's Tableaux 1809 Čelakovský's Rodový Kmen 1853 Rühling's Tabula 1774 Hicke's Affinitas 1689 Schottel's Tabelle 1663 List et al. (2016) 22 / 48
  91. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion Die phylogenetische Rekonstruktion 1700 1800

    1750 1850 Stiernhielm's Lingua Nova 1671 Gallet's Arbre ca. 1800 Darwin's Origins 1859 De Buffon's Table 1755 Schleicher's Stammbaum 1853 Darwin's Tree Sketch 1837 Lamarck's Tableaux 1809 Čelakovský's Rodový Kmen 1853 Rühling's Tabula 1774 Hicke's Affinitas 1689 Schottel's Tabelle 1663 List et al. (2016) Schleicher's Stammbaum 1853 22 / 48
  92. Klassischer Sprachvergleich Erkenntnisse Erkenntnisse des klassischen Sprachvergleichs 23 / 48

  93. Klassischer Sprachvergleich Erkenntnisse Erkenntnisse des klassischen Sprachvergleichs: Etymologie Frucht, ferner

    fruchten, befruchten, Befruchtung, fruchtbar, fruchtig Frucht f. ‘der Fortpflanzung der eigenen Art dienendes Produkt einer Pflanze’, auch ‘ungeborenes Lebewesen’, übertragen ‘Ertrag’, ahd. fruht (9. Jh.), mhd. vruht, asächs. fruht, mnd. mnl. nl. vrucht beruhen auf einer frühen Entlehnung von gleichbed. lat. frūctus, abgeleitet vom Verb lat. fruī (frūctus sum) ‘genießen, Nutzen ziehen’ (verwandt mit brauchen, s. d.). Das Deminutiv Früchtchen hat die spezielle Bedeutung [...] Dt. «Frucht» in Pfei�er (1993, auch unter https://dwds.de) 24 / 48
  94. Klassischer Sprachvergleich Erkenntnisse Erkenntnisse des klassischen Sprachvergleichs: Etymologie Frucht, ferner

    fruchten, befruchten, Befruchtung, fruchtbar, fruchtig Frucht f. ‘der Fortpflanzung der eigenen Art dienendes Produkt einer Pflanze’, auch ‘ungeborenes Lebewesen’, übertragen ‘Ertrag’, ahd. fruht (9. Jh.), mhd. vruht, asächs. fruht, mnd. mnl. nl. vrucht beruhen auf einer frühen Entlehnung von gleichbed. lat. frūctus, abgeleitet vom Verb lat. fruī (frūctus sum) ‘genießen, Nutzen ziehen’ (verwandt mit brauchen, s. d.). Das Deminutiv Früchtchen hat die spezielle Bedeutung [...] ererbt von entlehnt von abgeleited von PIE *bhreu◌◌◌̯ Hg◌ ◌ ◌ ̑ - «benutzen» PIE *bhruHg◌ ◌ ◌ ̑ -ié- «benutzen» (Präsens) Urg. *ƀrūkan- «benutzen» AHD brūhhan «benutzen» D brauchen «brauchen» D Brauch «Brauch» AHD fruht «Gewinn, Frucht» D frugal «spärlich» Fr fruit “profit,fruit” Fr frugal “modest (food)” Lt fruor, fruī «ich genieße» Lt frūctus «Gewinn» Lt frux «Frucht, Korn» Lt frugalis «Nutzen bringend» Nach einer Illustration von Hans Geisler (Universität Düsseldorf) [...] Deutsch «Frucht» in Pfei�er (1993, auch unter https://dwds.de) 24 / 48
  95. Klassischer Sprachvergleich Erkenntnisse Erkenntnisse des klassischen Sprachvergleichs: Phylogenie Indo-European 25

    / 48
  96. Klassischer Sprachvergleich Erkenntnisse Erkenntnisse des klassischen Sprachvergleichs: Phylogenie Sino-Tibetan Indo-European

    Afro-Asiatic Niger-Congo Austronesian Pama-Nyungan Otomanguean Arawakan Na-Dené Uralic Algonquian 25 / 48
  97. Klassischer Sprachvergleich Erkenntnisse Erkenntnisse des klassischen Sprachvergleichs: Phylogenie Indo-European Austronesian

    Algonquian 25 / 48
  98. Computergestützte Sprachforschung 26 / 48

  99. Sprachfamilien wie Sinotibetisch stellen "nahezu unüberwindbare Hindernisse" dar. (Antoine Meillet

    1925) Einsichten → Sprachwandel → Menschheitsgeschichte → Faktoren von Diversität in Sprache und Kultur → klassische Methoden stoßen an Grenzen → rein automatische Methoden ersetzen keine Expertenerfahrung und -intuition Hindernisse steigender Umfang von Datenmengen historischer Sprachvergleich große und diverse Sprachfamilien Heraus- forderungen Computergestützte Sprachforschung 26 / 48
  100. Sprachfamilien wie Sinotibetisch stellen "nahezu unüberwindbare Hindernisse" dar. (Antoine Meillet

    1925) Einsichten → Sprachwandel → Menschheitsgeschichte → Faktoren von Diversität in Sprache und Kultur → klassische Methoden stoßen an Grenzen → rein automatische Methoden ersetzen keine Expertenerfahrung und -intuition Hindernisse steigender Umfang von Datenmengen historischer Sprachvergleich große und diverse Sprachfamilien Heraus- forderungen Computergestützte Sprachforschung 26 / 48
  101. Sprachfamilien wie Sinotibetisch stellen "nahezu unüberwindbare Hindernisse" dar. (Antoine Meillet

    1925) Einsichten → Sprachwandel → Menschheitsgeschichte → Faktoren von Diversität in Sprache und Kultur → klassische Methoden stoßen an Grenzen → rein automatische Methoden ersetzen keine Expertenerfahrung und -intuition Hindernisse steigender Umfang von Datenmengen historischer Sprachvergleich große und diverse Sprachfamilien Heraus- forderungen Computergestützte Sprachforschung 26 / 48
  102. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Probleme des klassischen Sprachvergleichs

    27 / 48
  103. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Probleme des klassischen Sprachvergleichs

    fehlende Empirie (Lobpreis der Intuition) 27 / 48
  104. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Probleme des klassischen Sprachvergleichs

    fehlende Empirie (Lobpreis der Intuition) fehlende Fokussierung (mangelnde Interdisziplinarität) 27 / 48
  105. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Probleme des klassischen Sprachvergleichs

    fehlende Empirie (Lobpreis der Intuition) fehlende Fokussierung (mangelnde Interdisziplinarität) fehlende Transparenz der Analysen 27 / 48
  106. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Probleme des klassischen Sprachvergleichs

    fehlende Empirie (Lobpreis der Intuition) fehlende Fokussierung (mangelnde Interdisziplinarität) fehlende Transparenz der Analysen mangelnde Effizienz der Anwendung 27 / 48
  107. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Die quantitative Wende 2002

    2004 2006 2008 2010 2012 2014 28 / 48
  108. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Die quantitative Wende 2002

    2004 2006 2008 2010 2012 2014 28 / 48
  109. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Die quantitative Wende 2002

    2004 2006 2008 2010 2012 2014 28 / 48
  110. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Die quantitative Wende 2002

    2004 2006 2008 2010 2012 2014 28 / 48
  111. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Die quantitative Wende: Tragödie

    oder Schnulze? 29 / 48
  112. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Die quantitative Wende: Tragödie

    oder Schnulze? 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 10 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ?! ? 29 / 48
  113. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Die quantitative Wende: Tragödie

    oder Schnulze? 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 10 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 29 / 48
  114. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Die quantitative Wende: Tragödie

    oder Schnulze? 29 / 48
  115. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs Computergestützter Sprachvergleich very long

    title P(A|B)=P(B|A)... 30 / 48
  116. Computergestützte Sprachforschung Grundlegendes Grundlegendes zum computergestützten Sprachvergleich 31 / 48

  117. Computergestützte Sprachforschung Grundlegendes Grundlegendes zum computergestützten Sprachvergleich phylogenetische Rekonstruktion (Stammbäume,

    Datierung von Sprachfamilien) 31 / 48
  118. Computergestützte Sprachforschung Grundlegendes Grundlegendes zum computergestützten Sprachvergleich phylogenetische Rekonstruktion (Stammbäume,

    Datierung von Sprachfamilien) automatisierte Ansätze zur Etymologie (Erkennung von kognaten Wörtern, Alinierung, Ermittlung von Lautkorrespondenzen) 31 / 48
  119. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (allgemein) 0 H H H

    H H 0 0 H H H H 0 32 / 48
  120. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (allgemein) 0 H H H

    H H 0 0 H H H H 0 32 / 48
  121. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (allgemein) 0 H H H

    H H 0 0 H H H H H 0 32 / 48
  122. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (im Alltag) Taxon N. Sequence

    PLAGIARY 1 die Zurueckhaltung die im Umgang mit dem Foederalismusbegriff ORIGINAL 1 die Zurueckhaltung die im Umgang mit dem Foederalismusbegriff PLAGIARY 2 zu beobachten ist mag zu einem gewissen ..Teil. darauf zuruec ORIGINAL 2 zu beobachten ist mag ..........n.ich.t zuletzt darauf zuruec PLAGIARY 3 kzufuehren sein dass sich ...waehre.nd. des 19 Jahrhunderts e ORIGINAL 3 kzufuehren sein dass sich im v.e.r.lauf des 19 Jahrhunderts e HTL2 1 LDTAPCLFSDGS PQKAAYVLWDQTIL QQDITPLPSHETHSA QKGELLALIC Type (1) Plagiaterkennung (Ausschnitt von Guttenbergs Dissertation) 33 / 48
  123. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (im Alltag) Taxon N. Sequence

    HTL2 1 LDTAPCLFSDGS‑‑‑‑‑‑PQKAAYVLWDQTIL‑‑‑QQDITPLPSHETHSA QKGELLALIC MMLV 1 PDADHTWYTDGSSLLQEGQRKAGAAVTTETEVIWAKALDAG‑‑‑T‑‑‑SAQRAELIALTQA HTL2 2 GLRAAKPWPSLNIFLDSKYLIKYLHSLAIGAFLGTSAH‑‑‑‑‑‑‑‑‑QT‑LQAALPPLLQG MMLV 2 LKMAEGKK‑LNVYTDSRYAFATAHIHGEIYRRRGLLTSEGKEIKNKDE‑ILALLKALFLPK HTL2 3 KTIYLHHVRSHT‑NLPDPISTFNEYTDSLILAPL‑‑‑‑‑‑‑‑‑‑ MMLV 3 RLSIIHCPGHQ‑KGHSAEARGNRMADQAARKAAITETPDTSTLL Type (1) Sequenzvergleich in der Biologie 33 / 48
  124. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (im Alltag) Taxon N. Sequence

    WRONG 1 two b‑ or not two b‑ that is the question CORRECT 1 t‑o be or not t‑o be that is the question WRONG 2 Leavins‑t‑ine distance is the addict distance betwean strings CORRECT 2 Le‑venshtein‑ distance is the ed‑i‑t distance between strings WRONG 3 ”ad‑ress” ”concensus” and ”dependance” are of‑en misspelled CORRECT 3 ”address” ”consensus” and ”dependence” are often misspelled Type (1) Rechtschreibkorrektur 33 / 48
  125. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (in der Linguistik) Alinierungsanalysen 34

    / 48
  126. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (in der Linguistik) Alinierungsanalysen sind

    relativ leicht automatisierbar, 34 / 48
  127. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (in der Linguistik) Alinierungsanalysen sind

    relativ leicht automatisierbar, fördern die Transparenz der vergleichenden Sprachforschung, 34 / 48
  128. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (in der Linguistik) Alinierungsanalysen sind

    relativ leicht automatisierbar, fördern die Transparenz der vergleichenden Sprachforschung, können durch interaktive Software auch leicht manuell nachkorrigiert werden und 34 / 48
  129. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Alinierung (in der Linguistik) Alinierungsanalysen sind

    relativ leicht automatisierbar, fördern die Transparenz der vergleichenden Sprachforschung, können durch interaktive Software auch leicht manuell nachkorrigiert werden und sind daher ein perfektes Beispiel für computergestützte (im Gegensatz zu computerbasierter) Sprachforschung. 34 / 48
  130. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Computergestützte Alinierung EDICTOR Tool für computergestützte

    Alinierung (List 2017) 35 / 48
  131. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Computergestützte Alinierung EDICTOR Tool für computergestützte

    Alinierung (List 2017) 35 / 48
  132. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Computergestützte Alinierung EDICTOR Tool für computergestützte

    Alinierung (List 2017) 35 / 48
  133. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Computergestützte Alinierung EDICTOR Tool für computergestützte

    Alinierung (List 2017) 35 / 48
  134. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Computergestützte Alinierung EDICTOR Tool für computergestützte

    Alinierung (List 2017) 35 / 48
  135. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Computergestützte Alinierung EDICTOR Tool für computergestützte

    Alinierung (List 2017) 35 / 48
  136. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Computergestützte Alinierung EDICTOR Tool für computergestützte

    Alinierung (List 2017) 35 / 48
  137. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Computergestützte Alinierung EDICTOR Tool für computergestützte

    Alinierung (List 2017) 35 / 48
  138. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Computergestützte Alinierung EDICTOR Tool für computergestützte

    Alinierung (List 2017) 35 / 48
  139. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Computergestützte Alinierung EDICTOR Tool für computergestützte

    Alinierung (List 2017) 35 / 48
  140. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Computergestützte Alinierung List et al. (in

    Vorb.) 36 / 48
  141. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Phylogenetische Rekonstruktion Grundfragen der phylogenetischen Rekonstruktion:

    37 / 48
  142. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Phylogenetische Rekonstruktion Grundfragen der phylogenetischen Rekonstruktion:

    Wie alt ist eine Sprachfamilie? 37 / 48
  143. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Phylogenetische Rekonstruktion Grundfragen der phylogenetischen Rekonstruktion:

    Wie alt ist eine Sprachfamilie? Welche Wörter wurden in der Ursprache gesprochen? 37 / 48
  144. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Phylogenetische Rekonstruktion Grundfragen der phylogenetischen Rekonstruktion:

    Wie alt ist eine Sprachfamilie? Welche Wörter wurden in der Ursprache gesprochen? Wo sind Wörter erhalten geblieben, wo verloren gegangen? 37 / 48
  145. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Phylogenetische Rekonstruktion Grundfragen der phylogenetischen Rekonstruktion:

    Wie alt ist eine Sprachfamilie? Welche Wörter wurden in der Ursprache gesprochen? Wo sind Wörter erhalten geblieben, wo verloren gegangen? Was sagt uns das Vokabular der Ursprache über die ursprüngliche Gemeinschaft der Sprecher? 37 / 48
  146. Computergestützte Sprachforschung Grundlegendes Grundlegendes: Phylogenetische Rekonstruktion Fúzhōu Táiběi Xiàmén Zhāngpíng

    Mǐn Guǎngzhōu Měixiàn Liánchéng Hakka Wēnzhōu Níngbō Sūzhōu Shànghǎi Shànghǎi_B Wú Nánchāng Ānyì Gàn Chángshā Shuāngfēng Xiāng Yàngshān Wǔhàn Níngxià Chéngdū Běijīng Tàiyuán Yúcì Guānhuà 月 月娘 月光佛 月光 月亮 月明 ‘MOON’ ‘MOON-MOTHER’ ‘MOON-LIGHT’ ‘MOON-LIGHT-SUFFIX’ ‘MOON-SHINE’ ‘MOON-BRIGHT’ Geschichte des Worts für «Mond» in chinesischen Dialekten (List 2016) 38 / 48
  147. Computergestützte Sprachforschung Erkenntnisse Erkenntnisse des computergestützten Sprachvergleichs #MLGA (Make Linguistics

    Great Again!) 39 / 48
  148. Computergestützte Sprachforschung Erkenntnisse Erkenntnisse des computergestützten Sprachvergleichs #MLGA (Make Linguistics

    Great Again!) Der Bann von Sprachursprungsfragen durch die Société de Linguistique de Paris: Die Gesellschaft gestattet keinerlei Diskussion zum Ursprung der Sprache oder zur Erschaffung einer Universalsprache. («Statuts» 1871: III, meine Übersetzung) 39 / 48
  149. Computergestützte Sprachforschung Erkenntnisse Erkenntnisse des computergestützten Sprachvergleichs #MLGA (Make Linguistics

    Great Again!) Der Bann von Sprachursprungsfragen durch die Société de Linguistique de Paris: Die Gesellschaft gestattet keinerlei Diskussion zum Ursprung der Sprache oder zur Erschaffung einer Universalsprache. («Statuts» 1871: III, meine Übersetzung) Seit der quantitativen Wende stellen wir als Linguisten neue Fragen oder trauen uns, lange nicht beachtete Fragen endlich wieder zu stellen. 39 / 48
  150. Computergestützte Sprachforschung Erkenntnisse Erkenntnisse des computergestützten Sprachvergleichs Edit-Dist. SCA Infomap

    Bahnaric Chinese Huon Romance Tujia Uralic Turchin LexStat TOTAL true positive true negative false negative false positive Akkurazität automatischer Wortvergleiche (List et al. 2017) 40 / 48
  151. Computergestützte Sprachforschung Erkenntnisse Erkenntnisse des computergestützten Sprachvergleichs Automatische Methoden sollen

    die Forschungskräfte nicht überflüssig machen. 41 / 48
  152. Computergestützte Sprachforschung Erkenntnisse Erkenntnisse des computergestützten Sprachvergleichs Automatische Methoden sollen

    die Forschungskräfte nicht überflüssig machen. Sie sollen den Forschenden vielmehr durch das Übernehmen der langweiligen Aufgaben Zeit geben, sich wichtigeren Forschungsfragen zu widmen. 41 / 48
  153. Computergestützte Sprachforschung Erkenntnisse Erkenntnisse des computergestützten Sprachvergleichs Automatische Methoden sollen

    die Forschungskräfte nicht überflüssig machen. Sie sollen den Forschenden vielmehr durch das Übernehmen der langweiligen Aufgaben Zeit geben, sich wichtigeren Forschungsfragen zu widmen. Als Beispiel dient hier die moderne Biologie, wie auch die computergestützten Übersetzung. 41 / 48
  154. Sprachwandel Drüberhinaus Jenseits von Sprachwandel 42 / 48

  155. Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung 43 / 48

  156. Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung Wie können, sollen,

    oder müssen wir uns ausdrücken? 43 / 48
  157. Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung Wie können, sollen,

    oder müssen wir uns ausdrücken? 1 Mir tut der Kopf weh. 43 / 48
  158. Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung Wie können, sollen,

    oder müssen wir uns ausdrücken? 1 Mir tut der Kopf weh. 2 Mir dröhnt der Schädel. 43 / 48
  159. Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung Wie können, sollen,

    oder müssen wir uns ausdrücken? 1 Mir tut der Kopf weh. 2 Mir dröhnt der Schädel. 3 Meine Rübe pocht. 43 / 48
  160. Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung Wie können, sollen,

    oder müssen wir uns ausdrücken? 1 Mir tut der Kopf weh. 2 Mir dröhnt der Schädel. 3 Meine Rübe pocht. 4 Ich hab ein fieses Ziehen in der Stirn. 43 / 48
  161. Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung One beer please!

    A beer for me! Beer? Please? You have beer? I'm thirsty, but I do not drink water, can you help me? I want the same as everybody else here. 44 / 48
  162. Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung 44 / 48

  163. Jenseits von Sprachwandel Jenseits von Sprachwandel: Lexikalisierung 44 / 48

  164. Jenseits von Sprachwandel Jenseits von Sprachwandel: Polysemiedaten ID Konzept Russisch

    Deutsch ... 1.1 world mir, svet Welt ... 1.21 earth, land zemlja Erde, Land ... 1.212 ground, soil počva Erde, Boden ... 1.420 tree derevo Baum ... 1.430 wood derevo Wald ... ... ... ... ... ... 45 / 48
  165. Jenseits von Sprachwandel Jenseits von Sprachwandel: Polysemiedaten CLICS: Crosslinguistic Colexifications

    - 221 Sprachen - 64 Sprachfamilien - 1280 Konzepte - 301,498 Wörter - 45,667 Polysemien (Kolexifizierungen) - 16,239 unterschiedliche Links - http://clics.lingpy.org 45 / 48
  166. Jenseits von Sprachwandel Jenseits von Sprachwandel: Polysemiedaten 684 678 871

    1043 6 30 129 196 1243 128 869 853 650 344 1103 150 185 627 232 709 1035 1206 177 97 311 496 606 137 207 444 840 1077 325 222 1063 1138 1204 1258 559 723 495 766 914 38 1101 652 865 891 872 633 291 980 700 144 410 430 1025 406 464 787 622 131 242 918 275 1159 99 1174 671 1038 786 705 641 760 1259 356 391 197 10 214 299 63 191 619 644 792 1205 897 67 1231 213 226 747 681 399 841 439 773 123 800 16 1067 1227 696 417 550 68 76 108 360 1244 339 500 81 867 79 1097 98 96 833 771 715 455 380 1268 1186 1046 39 252 1228 66 23 1112 133 676 336 739 1150 1071 986 485 112 372 1109 830 721 1053 1057 601 573 556 527 1248 614 488 908 499 1002 309 442 814 1193 569 458 258 563 653 682 774 70 1151 948 801 1082 243 47 71 83 153 1265 934 85 1215 1199 523 581 422 21 358 1261 111 354 219 759 15 890 261 1222 141 158 74 806 1031 845 770 850 903 1224 419 754 433 798 188 1256 613 528 208 539 323 981 132 1055 1001 790 804 844 1118 907 640 446 815 923 498 201 1184 578 566 427 532 452 151 750 598 1094 345 735 777 978 599 492 390 286 1107 742 1015 1202 1210 1257 1275 859 988 69 752 596 290 126 110 950 922 1047 741 253 347 385 620 966 221 431 3 224 1194 999 953 1029 852 301 389 318 530 1048 1032 175 701 544 1119 241 94 745 835 1270 62 107 159 20 767 512 331 248 549 1013 946 974 1022 1100 477 302 233 1168 1003 1211 570 307 40 945 1269 784 546 437 901 350 238 305 1191 482 1012 977 906 783 524 117 457 603 836 1181 880 229 124 216 1113 1074 72 586 647 447 2 113 1179 7 1006 665 397 502 610 1274 707 327 659 667 824 917 985 1089 346 1229 101 542 1042 727 782 733 967 462 592 468 1106 440 478 308 577 698 776 75 1155 51 145 517 359 938 1157 1160 1183 947 1102 1135 1252 343 608 537 103 634 251 383 506 25 829 396 686 679 574 516 42 250 379 809 602 660 780 765 697 856 899 594 1008 393 179 114 1140 11 100 1209 618 600 192 1277 896 1142 1278 762 421 713 182 521 861 672 297 1116 1190 1192 140 1212 46 493 1187 157 1225 212 403 519 616 173 413 912 1110 84 756 793 636 118 889 692 998 366 711 1045 61 240 1263 199 648 832 289 522 368 1091 931 982 949 400 119 388 811 53 59 1069 708 952 545 763 1238 184 825 377 1242 1233 262 635 269 1062 1061 1073 933 17 1247 352 64 384 50 632 736 1246 822 781 758 1 939 595 778 105 860 1049 1066 1072 995 503 370 919 1149 1127 1128 972 1126 245 921 973 675 587 1235 960 928 926 1143 548 1250 86 1021 32 1068 719 965 259 1070 863 638 303 324 873 249 892 976 1007 722 36 459 293 165 209 557 1245 788 862 651 900 31 483 236 935 1052 115 294 680 831 44 453 206 971 1273 170 753 256 1148 200 450 382 1240 561 615 317 572 725 870 438 139 1011 646 1117 392 45 276 264 704 1080 174 1050 808 1197 508 576 225 562 471 1217 333 1014 593 92 1034 611 1171 312 802 1253 29 902 244 582 466 668 878 341 432 1163 625 904 164 467 1195 1232 796 828 281 629 349 1166 411 369 387 1208 394 415 1000 58 1098 148 287 1223 818 263 220 838 876 313 260 65 1165 5 355 106 1172 490 718 171 1139 163 785 881 887 1169 319 585 553 894 306 314 1041 1009 799 674 848 1201 1004 689 1085 1218 1145 1170 228 911 279 73 104 690 1254 402 340 169 693 868 893 1018 78 1092 194 555 198 834 1249 997 932 237 1176 666 956 624 1262 541 520 795 866 702 4 734 1095 1180 728 964 1079 271 842 1241 1056 154 751 353 905 1136 504 909 910 1133 362 583 670 1124 381 1216 215 178 571 470 142 376 1154 172 296 533 364 963 152 797 1213 803 1051 738 426 1036 1153 637 823 915 428 1075 560 547 1137 35 882 89 511 1122 805 494 1130 1188 1086 1236 669 588 930 703 942 18 655 335 155 710 1156 1028 465 147 183 414 1221 273 166 1054 278 55 460 812 1090 810 180 768 143 156 404 367 1182 231 288 136 456 82 529 970 1016 729 395 187 604 408 330 1064 34 1267 847 726 543 677 642 940 645 958 683 695 864 1058 605 1084 451 443 699 1167 959 925 1198 227 886 628 1178 337 991 813 657 1185 1039 769 1081 484 712 1189 944 1207 322 33 685 424 80 270 937 1177 283 1237 816 130 161 189 77 300 1026 463 1104 326 589 60 983 474 1093 744 748 554 292 41 267 984 373 1214 957 1024 969 507 37 874 1030 630 579 962 535 706 688 122 497 1060 1083 1027 102 510 405 1134 658 617 936 929 363 1175 361 536 534 1219 181 386 884 418 558 8 479 979 551 505 316 298 26 315 761 202 1144 176 473 348 134 639 663 717 885 924 149 49 1078 1040 57 167 764 1173 673 280 1152 277 1272 1065 272 827 531 607 1123 257 996 436 9 826 234 1096 875 525 304 1108 475 1132 714 846 540 716 1005 1105 357 1162 694 920 743 28 994 1200 168 1266 420 515 568 755 895 218 916 730 807 210 375 854 1010 879 1125 268 1129 1114 1255 1158 1279 487 486 398 597 661 135 565 621 193 321 1230 513 654 265 612 737 855 211 1196 246 1264 584 338 749 1271 434 121 423 509 839 1147 656 230 239 489 14 469 22 1044 351 448 282 329 961 254 989 371 284 223 843 821 24 1023 643 819 285 514 746 757 791 138 186 849 93 951 127 877 1088 518 1164 1260 501 54 190 95 43 205 1276 116 146 662 217 461 883 204 1033 310 472 12 412 332 817 649 794 1037 943 927 481 968 425 109 195 857 1121 564 687 664 724 87 1120 88 449 429 255 987 992 1111 591 575 491 720 851 328 941 990 1019 993 1087 955 580 1226 975 1099 732 235 779 365 1234 441 609 247 334 91 1251 1131 913 691 52 274 1017 435 90 407 480 1239 13 623 0 266 626 295 954 1059 552 898 858 772 526 1115 48 1161 125 590 454 1020 1141 203 740 1146 342 820 1220 56 320 416 27 401 476 19 120 1203 445 789 775 888 567 378 1076 160 162 409 731 631 374 538 837 45 / 48
  167. Jenseits von Sprachwandel Jenseits von Sprachwandel: Polysemiedaten Concept "money" is

    part of a cluster with the central concept "fishscale" with a total of 10 nodes. Hover over forms for each link. Click on the forms to check their sources. Click HERE to export the current network. ty: Line weights: Coloring: Family silver leather fishscale bark coin fur snail skin, hide money shell 49 links for "silver" and "money": Language Family Form 1. Ignaciano Arawakan ne 2. Aymara, Central Aymaran ḳulʸḳi 3. Tsafiki Barbacoan kaˈla 4. Seselwa Creole French Creole larzan 5. Miao, White Hmong-Mien nyiaj 6. Breton Indo-European arhant 7. French Indo-European argent 8. Gaelic, Irish Indo-European airgead 9. Welsh Indo-European arian 10. Cofán Isolate koriΦĩʔdi 45 / 48
  168. Jenseits von Sprachwandel Jenseits von Sprachwandel: Polysemiedaten Concept "wheel" is

    part of a cluster with the central concept "leg" with a total of 11 nodes. Hover over the e each link. Click on the forms to check their sources. Click HERE to export the current network. ity: Line weights: Coloring: Geolocation sphere, ball round footprint foot calf of leg circle thigh wheel leg hip buttocks 6 links for "foot" and "wheel": Language Family Form 1. Cofán Isolate c̷ɨʔtʰe 2. Puinave Isolate sim 3. Yaminahua Panoan taɨ 4. Wayampi Tupi pɨ 5. Pumé Unclassified taɔ 6. Ninam Yanomam mãhuk 45 / 48
  169. Ausblick 46 / 48

  170. Ausblick Ausblick 47 / 48

  171. Ausblick Ausblick Wo wird die vergleichende Sprachwissenschaft in fünf Jahren

    sein? 47 / 48
  172. Ausblick Ausblick Wo wird die vergleichende Sprachwissenschaft in fünf Jahren

    sein? Wir werden viel mehr Daten haben, darunter mehr leicht vergleichbare Daten. 47 / 48
  173. Ausblick Ausblick Wo wird die vergleichende Sprachwissenschaft in fünf Jahren

    sein? Wir werden viel mehr Daten haben, darunter mehr leicht vergleichbare Daten. Die Verwendung von Computern wird noch ein Stück normaler geworden sein für Linguisten. 47 / 48
  174. Ausblick Ausblick Wo wird die vergleichende Sprachwissenschaft in fünf Jahren

    sein? Wir werden viel mehr Daten haben, darunter mehr leicht vergleichbare Daten. Die Verwendung von Computern wird noch ein Stück normaler geworden sein für Linguisten. Auch wenn wir die ganz großen Fragen (Ursache des Sprachwandels, Ursprung der Sprache, automatische Erkennung von Fakenews) nicht lösen können, so werden wir doch mehr wissen, als heute. 47 / 48
  175. Danke fürs Zuhören! • Name: Dr. Johann-Mattis List • Forschungsprojekt:

    Computer-Assisted Language Comparison. Reconciling Computational and Classical Approaches in Historical Linguistics • Webseite: http://calc.digling.org • Projektdauer: April 2017-März 2022 • Institut: Max-Planck-Institute für Menschheits- geschichte, Jena LC CA COMPUTA- TIONAL HISTORICAL LINGUISTICS COMPA- RATIVE METHOD 48 / 48