Upgrade to Pro — share decks privately, control downloads, hide ads and more …

Sprachen als Schlüssel zur Vergangenheit

Sprachen als Schlüssel zur Vergangenheit

Talk held at the "Salon Sophie Charlotte" (2018/01/20, Berlin-Brandenburgische Akademie der Wissenschaften, Berlin)

Johann-Mattis List

January 20, 2018
Tweet

More Decks by Johann-Mattis List

Other Decks in Science

Transcript

  1. Sprachen als Schlüssel zur Vergangenheit
    Johann-Mattis List
    Forschungsgruppe «Computergestützter Sprachvergleich»
    Abteilung für linguistische und kulturelle Evolution
    Max-Planck-Institut für Menschheitsgeschichte
    Jena, Deutschland
    2018-01-20
    very
    long
    title
    P(A|B)=P(B|A)...
    1 / 48

    View full-size slide

  2. A A G T C T A G G T T A C C C G T A T Time (s)
    0.4 2
    -0.5396
    0.3128
    0
    Do languages grow on trees?
    Spure�
    der
    Vergangenhei�
    2 / 48

    View full-size slide

  3. A A G T C T A G G T T A C C C G T A T Time (s)
    0.4 2
    -0.5396
    0.3128
    0
    Do languages grow on trees?
    Spure�
    der
    Vergangenhei�
    2 / 48

    View full-size slide

  4. A A G T C T A G G T T A C C C G T A T
    Spure�
    der
    Vergangenhei�
    Time (s)
    0.4 2
    -0.5396
    0.3128
    0
    Do languages grow on trees?
    2 / 48

    View full-size slide

  5. Mei� Herr, bitt� auf
    keine� Fal� di�
    vergleichend�
    Sprachwissenscha�,
    di�
    Sprachwissenscha�
    führ� zu�
    Schlimmste�!
    2 / 48

    View full-size slide

  6. Inhalt
    1 Sprachwandel
    Sprachwandel im Alltag
    Sprachwandel als Sprachverfall
    Sprachwandel in der Forschung
    2 Klassischer Sprachvergleich
    Die komparative Methode
    Die phylogenetische Rekonstruktion
    Erkenntnisse
    3 Computergestützte Sprachforschung
    Probleme des klassischen Sprachvergleichs
    Grundlegendes
    Erkenntnisse
    4 Jenseits von Sprachwandel
    5 Ausblick
    3 / 48

    View full-size slide

  7. Sprachwandel
    4 / 48

    View full-size slide

  8. "Die Sprachen [ändern] sich [...] so lange sie leben.."
    (August Schleicher 1863)
    walkman
    Indogermanisch
    Germanisch
    Altenglisch
    Englisch
    p
    f
    f
    f
    ə
    a
    æ
    ɑː
    t
    d
    d
    ð


    e
    ə
    r
    r
    r
    r
    iPod
    Sprachwandel
    4 / 48

    View full-size slide

  9. "Die Sprachen [ändern] sich [...] so lange sie leben.."
    (August Schleicher 1863)
    walkman
    Indogermanisch
    Germanisch
    Altenglisch
    Englisch
    p
    f
    f
    f
    ə
    a
    æ
    ɑː
    t
    d
    d
    ð


    e
    ə
    r
    r
    r
    r
    iPod
    Sprachwandel
    4 / 48

    View full-size slide

  10. "Die Sprachen [ändern] sich [...] so lange sie leben.."
    (August Schleicher 1863)
    walkman
    Indogermanisch
    Germanisch
    Altenglisch
    Englisch
    p
    f
    f
    f
    ə
    a
    æ
    ɑː
    t
    d
    d
    ð


    e
    ə
    r
    r
    r
    r
    iPod
    Sprachwandel
    4 / 48

    View full-size slide

  11. "Die Sprachen [ändern] sich [...] so lange sie leben.."
    (August Schleicher 1863)
    walkman
    Indogermanisch
    Germanisch
    Altenglisch
    Englisch
    p
    f
    f
    f
    ə
    a
    æ
    ɑː
    t
    d
    d
    ð


    e
    ə
    r
    r
    r
    r
    iPod
    Sprachwandel
    4 / 48

    View full-size slide

  12. Sprachwandel Sprachwandel im Alltag
    Sprachwandel im Alltag: Wörter
    5 / 48

    View full-size slide

  13. Sprachwandel Sprachwandel im Alltag
    Sprachwandel im Alltag: Wörter
    5 / 48

    View full-size slide

  14. Sprachwandel Sprachwandel im Alltag
    Sprachwandel im Alltag: Wörter
    5 / 48

    View full-size slide

  15. Sprachwandel Sprachwandel im Alltag
    Sprachwandel im Alltag: Wortgeschichten
    6 / 48

    View full-size slide

  16. Sprachwandel Sprachwandel im Alltag
    Sprachwandel im Alltag: Wortgeschichten
    Komm� «pr��»
    eigentlic� vo�
    «Pr�tituiert�»?
    6 / 48

    View full-size slide

  17. Sprachwandel Sprachwandel im Alltag
    Sprachwandel im Alltag: Küchenetymologien
    7 / 48

    View full-size slide

  18. Sprachwandel Sprachwandel im Alltag
    Sprachwandel im Alltag: Küchenetymologien
    Konservativ kommt nicht von
    Konserve!
    Angela Merkel (10. April 2000)
    7 / 48

    View full-size slide

  19. Sprachwandel Sprachwandel im Alltag
    Sprachwandel im Alltag: Küchenetymologien
    konservativ
    Wortart Adjektiv
    Häufigkeit moderat
    Bedeutung «am Hergebrachten, Her-
    kömmlichen, Überlieferten
    hängend, festhaltend»
    Synonyme «bewahrend», «erhaltend»,
    «ohne Operation»
    Aussprache ˈkɔnzɛrvatiːf
    Ursprung Englisch conservative
    8 / 48

    View full-size slide

  20. Sprachwandel Sprachwandel im Alltag
    Sprachwandel im Alltag: Küchenetymologien
    Englisch conservative
    «antiquiert»
    Mittellatin conservativus
    «beschützend»
    Latein conservare
    «bewahren»
    Urromanisch *serwo-
    «Hirte»
    Urindogermanisch *ser-u-o
    «Beschützer»
    Adamische Sprache ???
    «?»
    8 / 48

    View full-size slide

  21. Sprachwandel Sprachwandel im Alltag
    Sprachwandel im Alltag: Küchenetymologien
    Konserve
    Wortart Substantiv
    Häufigkeit moderat
    Bedeutung «in einer [...] Büchse oder in
    einem Glas aufbewahrtes Nah-
    rungsmittel [...]»
    Synonyme «bewahrend», «erhaltend»,
    «ohne Operation»
    Aussprache kɔnzˈɛrvə
    Ursprung Mittellatein conserva
    8 / 48

    View full-size slide

  22. Sprachwandel Sprachwandel im Alltag
    Sprachwandel im Alltag: Küchenetymologien
    Mittellatein conserva
    «antiquiert»
    Mittellatein conserva
    «Eingelegtes»
    Latein conservare
    «bewahren»
    Urromanisch *serwo-
    «Hirte»
    Urindogermanisch *ser-u-o
    «Beschützer»
    Adamische Sprache ???
    «?»
    8 / 48

    View full-size slide

  23. Sprachwandel Sprachwandel im Alltag
    Sprachwandel im Alltag: Küchenetymologien
    Deutsch konservativ
    «antiquiert»
    Deutsch konservativ
    «antiquiert»
    Latein conservare
    «bewahren»
    Latein conservare
    «shepherd»
    Deutsch Konserve
    «Nahrungsmittelbüchse»
    Latein conservare
    «bewahren»
    8 / 48

    View full-size slide

  24. Sprachwandel Sprachwandel als Sprachverfall
    Sprachwandel als Sprachverfall
    Poeten der Tángzeit in China (618⚶906 n. Chr.)
    9 / 48

    View full-size slide

  25. Sprachwandel Sprachwandel als Sprachverfall
    Sprachwandel als Sprachverfall
    Poeten der Tángzeit in China (618⚶906 n. Chr.)
    Philosophen im alten Griechenland (ab 400 v. Chr.)
    9 / 48

    View full-size slide

  26. Sprachwandel Sprachwandel als Sprachverfall
    Sprachwandel als Sprachverfall
    Poeten der Tángzeit in China (618⚶906 n. Chr.)
    Philosophen im alten Griechenland (ab 400 v. Chr.)
    Redner im alten Rom (ab 100 v. Chr.)
    9 / 48

    View full-size slide

  27. Sprachwandel Sprachwandel als Sprachverfall
    Sprachwandel als Sprachverfall
    Poeten der Tángzeit in China (618⚶906 n. Chr.)
    Philosophen im alten Griechenland (ab 400 v. Chr.)
    Redner im alten Rom (ab 100 v. Chr.)
    Moderne Sprachpfleger wie B. Sick (2004)
    9 / 48

    View full-size slide

  28. Sprachwandel Sprachwandel als Sprachverfall
    Sprachwandel als Sprachverfall: Macht das Sinn?
    10 / 48

    View full-size slide

  29. Sprachwandel Sprachwandel als Sprachverfall
    Sprachwandel als Sprachverfall: Macht das Sinn?
    machen ← Indogermanisch *mag- «kneten»
    10 / 48

    View full-size slide

  30. Sprachwandel Sprachwandel als Sprachverfall
    Sprachwandel als Sprachverfall: Macht das Sinn?
    machen ← Indogermanisch *mag- «kneten»
    10 / 48

    View full-size slide

  31. Sprachwandel Sprachwandel als Sprachverfall
    Sprachwandel als Sprachverfall: Macht das Sinn?
    machen ← Indogermanisch *mag- «kneten»
    engl. to make = dt. machen
    10 / 48

    View full-size slide

  32. Sprachwandel Sprachwandel als Sprachverfall
    Sprachwandel als Sprachverfall: Fallverlust
    Ursprünglich:
    trotz + Dativ
    seit ca. 1800:
    trotz + Genitiv
    und
    trotz + Dativ
    11 / 48

    View full-size slide

  33. Sprachwandel Sprachwandel als Sprachverfall
    Sprachwandel als Sprachverfall: Fallverlust
    Ursprünglich:
    trotz + Dativ
    seit ca. 1800:
    trotz + Genitiv
    und
    trotz + Dativ
    11 / 48

    View full-size slide

  34. Sprachwandel Sprachwandel als Sprachverfall
    Sprachwandel als Sprachverfall: Fallverlust
    Ursprünglich:
    trotz + Dativ
    seit ca. 1800:
    trotz + Genitiv
    und
    trotz + Dativ
    11 / 48

    View full-size slide

  35. Sprachwandel Sprachwandel als Sprachverfall
    Sprachwandel als Sprachverfall: Fallverlust
    Trotz dem
    Dativ hat der
    Genitiv noch
    eine Chance!
    Ursprünglich:
    trotz + Dativ
    seit ca. 1800:
    trotz + Genitiv
    und
    trotz + Dativ
    11 / 48

    View full-size slide

  36. Sprachwandel Sprachwandel in der Forschung
    Sprachwandel in der Forschung
    Sprachwandel ist nicht Sprachverfall.
    12 / 48

    View full-size slide

  37. Sprachwandel Sprachwandel in der Forschung
    Sprachwandel in der Forschung
    Sprachwandel ist nicht Sprachverfall.
    Sprachwandel ist allgegenwärtig und unvermeidbar.
    12 / 48

    View full-size slide

  38. Sprachwandel Sprachwandel in der Forschung
    Sprachwandel in der Forschung
    Sprachwandel ist nicht Sprachverfall.
    Sprachwandel ist allgegenwärtig und unvermeidbar.
    Sprachwandel folgt in Teilen universellen Tendenzen und Trends.
    12 / 48

    View full-size slide

  39. Sprachwandel Sprachwandel in der Forschung
    Sprachwandel in der Forschung
    Sprachwandel ist nicht Sprachverfall.
    Sprachwandel ist allgegenwärtig und unvermeidbar.
    Sprachwandel folgt in Teilen universellen Tendenzen und Trends.
    Sprachwandel verläuft in Teilen systematisch.
    12 / 48

    View full-size slide

  40. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel
    Pfanne
    Pfund
    Pfau
    Apfel
    Hopfen
    Fanne
    Fund
    Fau
    Apfel
    Hopfen
    pan
    pound
    peacock
    apple
    hop
    13 / 48

    View full-size slide

  41. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel
    Pfanne
    Pfund
    Pfau
    Apfel
    Hopfen
    Fanne
    Fund
    Fau
    Apfel
    Hopfen
    pan
    pound
    peacock
    apple
    hop
    13 / 48

    View full-size slide

  42. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel
    Pfanne
    Pfund
    Pfau
    Apfel
    Hopfen
    Fanne
    Fund
    Fau
    Apfel
    Hopfen
    pan
    pound
    peacock
    apple
    hops
    13 / 48

    View full-size slide

  43. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel
    Pfanne
    Pfund
    Pfau
    Apfel
    Hopfen
    Fanne
    Fund
    Fau
    Apfel
    Hopfen
    pan
    pound
    peacock
    apple
    hops
    p → pf → f
    13 / 48

    View full-size slide

  44. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel
    Jacob
    Grimm
    Rasmus
    Rask
    Undersøgelse
    om det gamle
    Nordiske
    Sprogs
    Oprindelse
    1818
    Deutsche
    Grammatik
    (Ausgabe
    II)
    1822
    Icelandic
    Sanskrit
    Old Greek
    Latin
    13 / 48

    View full-size slide

  45. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel
    Icelandic
    Old Indian
    Old Greek
    Latin
    Sanskrit
    Jacob
    Grimm
    Rasmus
    Rask
    Undersøgelse
    om det gamle
    Nordiske
    Sprogs
    Oprindelse
    1818
    Deutsche
    Grammatik
    (Ausgabe
    II)
    1822
    13 / 48

    View full-size slide

  46. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel
    Icelandic
    Old Indian
    Old Greek
    Latin
    Sanskrit
    Indo-European
    Method for Language Comparison
    • intensive language comparison
    • identify regularly recurring similaritities
    → prove language relationship
    → reconstruct development of language families
    Jacob
    Grimm
    Rasmus
    Rask
    Undersøgelse
    om det gamle
    Nordiske
    Sprogs
    Oprindelse
    1818
    Deutsche
    Grammatik
    (Ausgabe
    II)
    1822
    13 / 48

    View full-size slide

  47. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel
    Old Indian
    Old Greek
    Latin
    pe
    d-
    πο
    d-

    da
    "Fuß"
    Icelandic

    tur
    fótur
    ped-
    ποd-
    pāda
    13 / 48

    View full-size slide

  48. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel
    Old Indian
    Old Greek
    Latin
    "Fuß"
    Icelandic
    fótur
    ped-
    ποd-
    pāda
    pāda
    fótur
    pet-
    ποd-
    ótur
    ed-
    οd-
    āda
    Icelandic
    Latin
    Old Greek
    Old Indian
    f
    p
    π
    p itar-
    f
    p
    π
    p
    aðir
    ater
    atήr
    13 / 48

    View full-size slide

  49. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel
    Old Indian
    Old Greek
    Latin
    Icelandic
    faðir
    pater
    πatήr
    pitar-
    "Vater"
    faðir
    pater
    πatήr
    pitar-
    ótur
    ed-
    οd-
    āda
    Icelandic
    Latin
    Old Greek
    Old Indian
    f
    p
    π
    p itar-
    f
    p
    π
    p
    aðir
    ater
    atήr
    13 / 48

    View full-size slide

  50. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel
    Old Indian
    Old Greek
    Latin
    Icelandic
    faðir
    pater
    πatήr
    pitar-
    "Vater"
    ótur
    ed-
    οd-
    āda
    Icelandic
    Latin
    Old Greek
    Old Indian
    f
    p
    π
    p itar-
    f
    p
    π
    p
    aðir
    ater
    atήr
    13 / 48

    View full-size slide

  51. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel: Lautgesetze
    Aller lautwandel, soweit er mechanisch vor sich geht, vollzieht sich
    nach ausnahmslosen gesetzen, d.h. die richtung der lautbewegung
    ist bei allen angehörigen einer sprachgenossenschaft, ausser dem
    Fall, dass dialektspaltung eintritt, stets dieselbe, und alle wörter,
    in denen der der lautbewegung unterworfene laut unter gleichen
    verhältnissen erscheint, werden ohne ausnahme von der änderung
    ergriffen. (Osthoff und Brugmann 1878: XIII)
    14 / 48

    View full-size slide

  52. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel: Wandel des Alphabets
    15 / 48

    View full-size slide

  53. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel: Wandel des Alphabets
    Was ist das für
    ein Buchstabe?
    Das ist ein P.
    15 / 48

    View full-size slide

  54. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel: Wandel des Alphabets
    Was ist das für
    ein Buchstabe?
    Das ist ein P.
    Ich püsse euch alle, ganz besonders Averell,
    meinen Pleinen.
    Das
    reicht!
    15 / 48

    View full-size slide

  55. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel: Wandel des Alphabets
    Was ist das für
    ein Buchstabe?
    Das ist ein P.
    Ich püsse euch alle, ganz besonders Averell,
    meinen Pleinen.
    Das
    reicht!
    Aber wohin gehen wir, wenn
    man uns wieder einfängt?
    Plappe
    Pleiner!
    15 / 48

    View full-size slide

  56. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel: Wandel des Alphabets
    Was ist das für
    ein Buchstabe?
    Das ist ein P.
    Ich püsse euch alle, ganz besonders Averell,
    meinen Pleinen.
    Das
    reicht!
    Aber wohin gehen wir, wenn
    man uns wieder einfängt?
    Plappe
    Pleiner!
    Liebe Kinder,
    heute habe ich
    Lucky Luke
    getroffen. Ich
    küsse euch,
    ganz besonders
    Averell, meinen
    Kleinen!
    Eure Ma Dalton
    15 / 48

    View full-size slide

  57. Sprachwandel Sprachwandel in der Forschung
    Lautwandel als Systemwandel: Wandel des Alphabets
    Was ist das für
    ein Buchstabe?
    Das ist ein P.
    Ich püsse euch alle, ganz besonders Averell,
    meinen Pleinen.
    Das
    reicht!
    Aber wohin gehen wir, wenn
    man uns wieder einfängt?
    Plappe
    Pleiner!
    Liebe Pinder,
    heute habe ich
    Lucpy Lupe
    getroffen. Ich
    püsse euch,
    ganz besonders
    Averell, meinen
    Pleinen!
    Eure Ma Dalton
    15 / 48

    View full-size slide

  58. Klassischer Sprachvergleich
    16 / 48

    View full-size slide

  59. [Der historische Sprachvergleich] hat es mit den
    trockensten Einzelthatsachen zu thun [...]. Was sonst
    die Wissenschaft von den Sprachen [...] zu einer der
    lebensvollsten macht, das tritt hier zunächst zurück.
    [...] Der Sprachhistoriker steht draußen vor seinem
    Gegenstande: hier der Anatom, da der Cadaver.
    Georg von der Gabelentz (1891)
    Klassischer Sprachvergleich
    16 / 48

    View full-size slide

  60. [Der historische Sprachvergleich] hat es mit den
    trockensten Einzelthatsachen zu thun [...]. Was sonst
    die Wissenschaft von den Sprachen [...] zu einer der
    lebensvollsten macht, das tritt hier zunächst zurück.
    [...] Der Sprachhistoriker steht draußen vor seinem
    Gegenstande: hier der Anatom, da der Cadaver.
    Georg von der Gabelentz (1891)
    Klassischer Sprachvergleich
    16 / 48

    View full-size slide

  61. [Der historische Sprachvergleich] hat es mit den
    trockensten Einzelthatsachen zu thun [...]. Was sonst
    die Wissenschaft von den Sprachen [...] zu einer der
    lebensvollsten macht, das tritt hier zunächst zurück.
    [...] Der Sprachhistoriker steht draußen vor seinem
    Gegenstande: hier der Anatom, da der Cadaver.
    Georg von der Gabelentz (1891)
    Klassischer Sprachvergleich
    16 / 48

    View full-size slide

  62. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode
    17 / 48

    View full-size slide

  63. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode
    Offiziell:
    17 / 48

    View full-size slide

  64. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode
    Offiziell:
    Die Kernmethode des historischen Sprachvergleichs.
    17 / 48

    View full-size slide

  65. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode
    Offiziell:
    Die Kernmethode des historischen Sprachvergleichs.
    Das unantastbare Fundament, auf dem die historische Linguistik steht.
    17 / 48

    View full-size slide

  66. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode
    Offiziell:
    Die Kernmethode des historischen Sprachvergleichs.
    Das unantastbare Fundament, auf dem die historische Linguistik steht.
    Tatsächlich:
    17 / 48

    View full-size slide

  67. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode
    Offiziell:
    Die Kernmethode des historischen Sprachvergleichs.
    Das unantastbare Fundament, auf dem die historische Linguistik steht.
    Tatsächlich:
    Ein Oberbegriff für ein Sammelsurium an verschiedenen kaum
    standardisierten Techniken, die beständig weiterentwickelt werden.
    17 / 48

    View full-size slide

  68. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode
    Offiziell:
    Die Kernmethode des historischen Sprachvergleichs.
    Das unantastbare Fundament, auf dem die historische Linguistik steht.
    Tatsächlich:
    Ein Oberbegriff für ein Sammelsurium an verschiedenen kaum
    standardisierten Techniken, die beständig weiterentwickelt werden.
    Besser verstanden als ein Coverterm für alle Methoden des
    historischen Sprachvergleichs.
    17 / 48

    View full-size slide

  69. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Kognaten und Korrespondenzen
    Nase
    Nass
    Muse
    muss
    singen
    18 / 48

    View full-size slide

  70. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Kognaten und Korrespondenzen
    Nase
    Nass
    Muse
    muss
    singen
    m → b
    n → d
    ng → g
    ss → f
    s → w
    18 / 48

    View full-size slide

  71. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Kognaten und Korrespondenzen
    Nase
    Nass
    Muse
    muss
    singen
    Dase
    Dass
    Buse
    buss
    sigen
    Nawe
    Naf
    Muwe
    muf
    wingen
    18 / 48

    View full-size slide

  72. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Kognaten und Korrespondenzen
    *Nase
    *Nass
    *Muse
    *muss
    *singen
    Dase
    Dass
    Buse
    buss
    sigen
    Nawe
    Naf
    Muwe
    muf
    wingen
    18 / 48

    View full-size slide

  73. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Englisch und Deutsch
    Kognatenliste Alinierung Korrespondenzliste
    Deutsch dünn d ʏ n DEU ENG Frequ.
    d θ 3 x
    d d 1 x
    n n 2 x
    m m 1 x
    ŋ ŋ 1 x
    Englisch thin θ ɪ n
    Deutsch Ding d ɪ ŋ
    English thing θ ɪ ŋ
    Deutsch dumm d ʊ m
    Englisch dumb d ʌ m
    Deutsch Dorn d ɔɐ n
    Englisch thorn θ ɔː n
    ... ... ...
    irreguläre
    Korrespondenz!
    19 / 48

    View full-size slide

  74. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Englisch und Deutsch
    Kognatenliste Alinierung Korrespondenzliste
    Deutsch dünn d ʏ n DEU ENG Frequ.
    d θ 3 x
    d d 1 x
    n n 2 x
    m m 1 x
    ŋ ŋ 1 x
    Englisch thin θ ɪ n
    Deutsch Ding d ɪ ŋ
    English thing θ ɪ ŋ
    Deutsch dumm d ʊ m
    Englisch dumb d ʌ m
    Deutsch Dorn d ɔɐ n
    Englisch thorn θ ɔː n
    ... ... ...
    irreguläre
    Korrespondenz!
    19 / 48

    View full-size slide

  75. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Englisch und Deutsch
    Kognatenliste Alinierung Korrespondenzliste
    Deutsch dünn d ʏ n DEU ENG Frequ.
    d θ 3 x
    d d 1 x
    n n 2 x
    m m 1 x
    ŋ ŋ 1 x
    Englisch thin θ ɪ n
    Deutsch Ding d ɪ ŋ
    English thing θ ɪ ŋ
    Deutsch dumm d ʊ m
    Englisch dumb d ʌ m
    Deutsch Dorn d ɔɐ n
    Englisch thorn θ ɔː n
    ... ... ...
    19 / 48

    View full-size slide

  76. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Englisch und Deutsch
    Kognatenliste Alinierung Korrespondenzliste
    Deutsch dünn d ʏ n DEU ENG Frequ.
    d θ 3 x
    d d 1 x
    n n 2 x
    m m 1 x
    ŋ ŋ 1 x
    Englisch thin θ ɪ n
    Deutsch Ding d ɪ ŋ
    English thing θ ɪ ŋ
    Deutsch dumm d ʊ m
    Englisch dumb d ʌ m
    Deutsch Dorn d ɔɐ n
    Englisch thorn θ ɔː n
    ... ... ...
    19 / 48

    View full-size slide

  77. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Englisch und Deutsch
    Kognatenliste Alinierung Korrespondenzliste
    Deutsch dünn d ʏ n DEU ENG Frequ.
    d θ 3 x
    d d 1 x
    n n 2 x
    m m 1 x
    ŋ ŋ 1 x
    Englisch thin θ ɪ n
    Deutsch Ding d ɪ ŋ
    English thing θ ɪ ŋ
    Deutsch dumm d ʊ m
    Englisch dumb d ʌ m
    Deutsch Dorn d ɔɐ n
    Englisch thorn θ ɔː n
    ... ... ...
    19 / 48

    View full-size slide

  78. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Englisch und Deutsch
    Kognatenliste Alinierung Korrespondenzliste
    Deutsch dünn d ʏ n DEU ENG Frequ.
    d θ 3 x
    d d 1 x
    n n 2 x
    m m 1 x
    ŋ ŋ 1 x
    Englisch thin θ ɪ n
    Deutsch Ding d ɪ ŋ
    English thing θ ɪ ŋ
    Deutsch dumm d ʊ m
    Englisch dumb d ʌ m
    Deutsch Dorn d ɔɐ n
    Englisch thorn θ ɔː n
    ... ... ...
    19 / 48

    View full-size slide

  79. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Englisch und Deutsch
    Kognatenliste Alinierung Korrespondenzliste
    Deutsch dünn d ʏ n DEU ENG Frequ.
    d θ 3 x
    d d 1 x
    n n 2 x
    m m 1 x
    ŋ ŋ 1 x
    Englisch thin θ ɪ n
    Deutsch Ding d ɪ ŋ
    English thing θ ɪ ŋ
    Deutsch dumm d ʊ m
    Englisch dumb d ʌ m
    Deutsch Dorn d ɔɐ n
    Englisch thorn θ ɔː n
    ... ... ...
    19 / 48

    View full-size slide

  80. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Englisch und Deutsch
    Kognatenliste Alinierung Korrespondenzliste
    Deutsch dünn d ʏ n DEU ENG Frequ.
    d θ 3 x
    d d 1 x
    n n 2 x
    m m 1 x
    ŋ ŋ 1 x
    Englisch thin θ ɪ n
    Deutsch Ding d ɪ ŋ
    English thing θ ɪ ŋ
    Deutsch dumm d ʊ m
    Englisch dumb d ʌ m
    Deutsch Dorn d ɔɐ n
    Englisch thorn θ ɔː n
    ... ... ...
    irreguläre
    Korrespondenz!
    19 / 48

    View full-size slide

  81. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Fazit
    20 / 48

    View full-size slide

  82. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Fazit
    Dank der Systematizität des Sprachwandels können wir im Rahmen
    des historischen Sprachvergleichs relativ sicher verwandte (kognate)
    Wörter ermitteln.
    20 / 48

    View full-size slide

  83. Klassischer Sprachvergleich Die komparative Methode
    Die komparative Methode: Fazit
    Dank der Systematizität des Sprachwandels können wir im Rahmen
    des historischen Sprachvergleichs relativ sicher verwandte (kognate)
    Wörter ermitteln.
    Obwohl das Verfahren zum Ermitteln von Lautkorrespondenzen und
    kognaten Wörtern sehr formal gefasst und beschrieben werden kann,
    wird es vorwiegend manuell ausgeführt.
    20 / 48

    View full-size slide

  84. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion
    Die phylogenetische Rekonstruktion
    21 / 48

    View full-size slide

  85. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion
    Die phylogenetische Rekonstruktion
    Unter phylogenetischer Rekonstruktion verstehen wir den Versuch, die
    Entwicklung einer Sprachfamilie in Form von Stammbäumen
    darzustellen.
    21 / 48

    View full-size slide

  86. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion
    Die phylogenetische Rekonstruktion
    Unter phylogenetischer Rekonstruktion verstehen wir den Versuch, die
    Entwicklung einer Sprachfamilie in Form von Stammbäumen
    darzustellen.
    Die klassische phylogenetische Rekonstruktion in der Linguistik ist der
    Kladistik sehr ähnlich, wurde aber viel früher entwickelt.
    21 / 48

    View full-size slide

  87. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion
    Die phylogenetische Rekonstruktion
    Unter phylogenetischer Rekonstruktion verstehen wir den Versuch, die
    Entwicklung einer Sprachfamilie in Form von Stammbäumen
    darzustellen.
    Die klassische phylogenetische Rekonstruktion in der Linguistik ist der
    Kladistik sehr ähnlich, wurde aber viel früher entwickelt.
    Leider sind die Kriterien für die Verfahren kaum formalisiert und
    werden auch selten transparent angewendet.
    21 / 48

    View full-size slide

  88. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion
    Die phylogenetische Rekonstruktion
    1700 1800
    1750 1850
    Stiernhielm's
    Lingua Nova
    1671
    Gallet's
    Arbre
    ca. 1800
    Darwin's
    Origins
    1859
    De Buffon's
    Table
    1755
    Schleicher's
    Stammbaum
    1853
    Darwin's
    Tree Sketch
    1837
    Lamarck's
    Tableaux
    1809
    Čelakovský's
    Rodový Kmen
    1853
    Rühling's
    Tabula
    1774
    Hicke's
    Affinitas
    1689
    Schottel's
    Tabelle
    1663
    List et al. (2016)
    22 / 48

    View full-size slide

  89. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion
    Die phylogenetische Rekonstruktion
    1700 1800
    1750 1850
    Stiernhielm's
    Lingua Nova
    1671
    Gallet's
    Arbre
    ca. 1800
    Darwin's
    Origins
    1859
    De Buffon's
    Table
    1755
    Schleicher's
    Stammbaum
    1853
    Darwin's
    Tree Sketch
    1837
    Lamarck's
    Tableaux
    1809
    Čelakovský's
    Rodový Kmen
    1853
    Rühling's
    Tabula
    1774
    Hicke's
    Affinitas
    1689
    Schottel's
    Tabelle
    1663
    List et al. (2016)
    22 / 48

    View full-size slide

  90. Klassischer Sprachvergleich Die phylogenetische Rekonstruktion
    Die phylogenetische Rekonstruktion
    1700 1800
    1750 1850
    Stiernhielm's
    Lingua Nova
    1671
    Gallet's
    Arbre
    ca. 1800
    Darwin's
    Origins
    1859
    De Buffon's
    Table
    1755
    Schleicher's
    Stammbaum
    1853
    Darwin's
    Tree Sketch
    1837
    Lamarck's
    Tableaux
    1809
    Čelakovský's
    Rodový Kmen
    1853
    Rühling's
    Tabula
    1774
    Hicke's
    Affinitas
    1689
    Schottel's
    Tabelle
    1663
    List et al. (2016)
    Schleicher's
    Stammbaum
    1853
    22 / 48

    View full-size slide

  91. Klassischer Sprachvergleich Erkenntnisse
    Erkenntnisse des klassischen Sprachvergleichs
    23 / 48

    View full-size slide

  92. Klassischer Sprachvergleich Erkenntnisse
    Erkenntnisse des klassischen Sprachvergleichs: Etymologie
    Frucht, ferner fruchten, befruchten, Befruchtung,
    fruchtbar, fruchtig
    Frucht f. ‘der Fortpflanzung der eigenen Art dienendes
    Produkt einer Pflanze’, auch ‘ungeborenes Lebewesen’,
    übertragen ‘Ertrag’, ahd. fruht (9. Jh.), mhd. vruht,
    asächs. fruht, mnd. mnl. nl. vrucht beruhen auf einer
    frühen Entlehnung von gleichbed. lat. frūctus,
    abgeleitet vom Verb lat. fruī (frūctus sum) ‘genießen,
    Nutzen ziehen’ (verwandt mit brauchen, s. d.). Das
    Deminutiv Früchtchen hat die spezielle Bedeutung
    [...]
    Dt. «Frucht» in Pfei�er (1993, auch unter https://dwds.de)
    24 / 48

    View full-size slide

  93. Klassischer Sprachvergleich Erkenntnisse
    Erkenntnisse des klassischen Sprachvergleichs: Etymologie
    Frucht, ferner fruchten, befruchten, Befruchtung,
    fruchtbar, fruchtig
    Frucht f. ‘der Fortpflanzung der eigenen Art dienendes
    Produkt einer Pflanze’, auch ‘ungeborenes Lebewesen’,
    übertragen ‘Ertrag’, ahd. fruht (9. Jh.), mhd. vruht,
    asächs. fruht, mnd. mnl. nl. vrucht beruhen auf einer
    frühen Entlehnung von gleichbed. lat. frūctus,
    abgeleitet vom Verb lat. fruī (frūctus sum) ‘genießen,
    Nutzen ziehen’ (verwandt mit brauchen, s. d.). Das
    Deminutiv Früchtchen hat die spezielle Bedeutung
    [...]
    ererbt von
    entlehnt von
    abgeleited von
    PIE *bhreu◌◌◌̯
    Hg◌


    ̑
    -
    «benutzen»
    PIE *bhruHg◌


    ̑
    -ié-
    «benutzen» (Präsens)
    Urg. *ƀrūkan-
    «benutzen»
    AHD brūhhan
    «benutzen»
    D brauchen
    «brauchen»
    D Brauch
    «Brauch»
    AHD fruht
    «Gewinn, Frucht»
    D frugal
    «spärlich»
    Fr fruit
    “profit,fruit”
    Fr frugal
    “modest (food)”
    Lt fruor, fruī
    «ich genieße»
    Lt frūctus
    «Gewinn»
    Lt frux
    «Frucht, Korn»
    Lt frugalis
    «Nutzen bringend»
    Nach einer Illustration von Hans Geisler (Universität Düsseldorf)
    [...]
    Deutsch «Frucht» in Pfei�er (1993,
    auch unter https://dwds.de)
    24 / 48

    View full-size slide

  94. Klassischer Sprachvergleich Erkenntnisse
    Erkenntnisse des klassischen Sprachvergleichs: Phylogenie
    Indo-European
    25 / 48

    View full-size slide

  95. Klassischer Sprachvergleich Erkenntnisse
    Erkenntnisse des klassischen Sprachvergleichs: Phylogenie
    Sino-Tibetan
    Indo-European
    Afro-Asiatic
    Niger-Congo
    Austronesian
    Pama-Nyungan
    Otomanguean
    Arawakan
    Na-Dené
    Uralic
    Algonquian
    25 / 48

    View full-size slide

  96. Klassischer Sprachvergleich Erkenntnisse
    Erkenntnisse des klassischen Sprachvergleichs: Phylogenie
    Indo-European
    Austronesian
    Algonquian
    25 / 48

    View full-size slide

  97. Computergestützte Sprachforschung
    26 / 48

    View full-size slide

  98. Sprachfamilien wie Sinotibetisch stellen
    "nahezu unüberwindbare Hindernisse" dar.
    (Antoine Meillet 1925)
    Einsichten
    → Sprachwandel
    → Menschheitsgeschichte
    → Faktoren von Diversität in Sprache und Kultur
    → klassische Methoden stoßen an Grenzen
    → rein automatische Methoden ersetzen keine
    Expertenerfahrung und -intuition
    Hindernisse
    steigender Umfang von Datenmengen
    historischer Sprachvergleich
    große und diverse Sprachfamilien
    Heraus-
    forderungen
    Computergestützte Sprachforschung
    26 / 48

    View full-size slide

  99. Sprachfamilien wie Sinotibetisch stellen
    "nahezu unüberwindbare Hindernisse" dar.
    (Antoine Meillet 1925)
    Einsichten
    → Sprachwandel
    → Menschheitsgeschichte
    → Faktoren von Diversität in Sprache und Kultur
    → klassische Methoden stoßen an Grenzen
    → rein automatische Methoden ersetzen keine
    Expertenerfahrung und -intuition
    Hindernisse
    steigender Umfang von Datenmengen
    historischer Sprachvergleich
    große und diverse Sprachfamilien
    Heraus-
    forderungen
    Computergestützte Sprachforschung
    26 / 48

    View full-size slide

  100. Sprachfamilien wie Sinotibetisch stellen
    "nahezu unüberwindbare Hindernisse" dar.
    (Antoine Meillet 1925)
    Einsichten
    → Sprachwandel
    → Menschheitsgeschichte
    → Faktoren von Diversität in Sprache und Kultur
    → klassische Methoden stoßen an Grenzen
    → rein automatische Methoden ersetzen keine
    Expertenerfahrung und -intuition
    Hindernisse
    steigender Umfang von Datenmengen
    historischer Sprachvergleich
    große und diverse Sprachfamilien
    Heraus-
    forderungen
    Computergestützte Sprachforschung
    26 / 48

    View full-size slide

  101. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Probleme des klassischen Sprachvergleichs
    27 / 48

    View full-size slide

  102. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Probleme des klassischen Sprachvergleichs
    fehlende Empirie (Lobpreis der Intuition)
    27 / 48

    View full-size slide

  103. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Probleme des klassischen Sprachvergleichs
    fehlende Empirie (Lobpreis der Intuition)
    fehlende Fokussierung (mangelnde Interdisziplinarität)
    27 / 48

    View full-size slide

  104. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Probleme des klassischen Sprachvergleichs
    fehlende Empirie (Lobpreis der Intuition)
    fehlende Fokussierung (mangelnde Interdisziplinarität)
    fehlende Transparenz der Analysen
    27 / 48

    View full-size slide

  105. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Probleme des klassischen Sprachvergleichs
    fehlende Empirie (Lobpreis der Intuition)
    fehlende Fokussierung (mangelnde Interdisziplinarität)
    fehlende Transparenz der Analysen
    mangelnde Effizienz der Anwendung
    27 / 48

    View full-size slide

  106. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Die quantitative Wende
    2002 2004 2006 2008 2010 2012 2014
    28 / 48

    View full-size slide

  107. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Die quantitative Wende
    2002 2004 2006 2008 2010 2012 2014
    28 / 48

    View full-size slide

  108. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Die quantitative Wende
    2002 2004 2006 2008 2010 2012 2014
    28 / 48

    View full-size slide

  109. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Die quantitative Wende
    2002 2004 2006 2008 2010 2012 2014
    28 / 48

    View full-size slide

  110. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Die quantitative Wende: Tragödie oder Schnulze?
    29 / 48

    View full-size slide

  111. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Die quantitative Wende: Tragödie oder Schnulze?
    1
    1
    1 1 1
    1 1 1
    1 1 1
    1
    1 1
    1
    1
    1
    1 1
    1
    1
    1 1
    1
    1
    1
    1 1
    1
    1 1 1 1
    1 1 1
    1 1
    1
    1
    1
    1
    1 1
    1
    1
    1
    1
    10
    0
    0
    0
    0 0
    0
    0
    0
    0
    0
    0 0
    0
    0
    0
    0
    0 0 0
    0
    0 0
    0 0
    0
    0
    0
    0
    0 0 0
    0
    0
    0
    0
    0
    ?!
    ?
    29 / 48

    View full-size slide

  112. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Die quantitative Wende: Tragödie oder Schnulze?
    1
    1
    1 1 1
    1 1 1
    1 1 1
    1
    1 1
    1
    1
    1
    1 1
    1
    1
    1 1
    1
    1
    1
    1 1
    1
    1 1 1 1
    1 1 1
    1 1
    1
    1
    1
    1
    1 1
    1
    1
    1
    1
    10
    0
    0
    0
    0 0
    0
    0
    0
    0
    0
    0 0
    0
    0
    0
    0
    0 0 0
    0
    0 0
    0 0
    0
    0
    0
    0
    0 0 0
    0
    0
    0
    0
    0
    29 / 48

    View full-size slide

  113. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Die quantitative Wende: Tragödie oder Schnulze?
    29 / 48

    View full-size slide

  114. Computergestützte Sprachforschung Probleme des klassischen Sprachvergleichs
    Computergestützter Sprachvergleich
    very
    long
    title
    P(A|B)=P(B|A)...
    30 / 48

    View full-size slide

  115. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes zum computergestützten Sprachvergleich
    31 / 48

    View full-size slide

  116. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes zum computergestützten Sprachvergleich
    phylogenetische Rekonstruktion (Stammbäume, Datierung von
    Sprachfamilien)
    31 / 48

    View full-size slide

  117. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes zum computergestützten Sprachvergleich
    phylogenetische Rekonstruktion (Stammbäume, Datierung von
    Sprachfamilien)
    automatisierte Ansätze zur Etymologie (Erkennung von kognaten
    Wörtern, Alinierung, Ermittlung von Lautkorrespondenzen)
    31 / 48

    View full-size slide

  118. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Alinierung (allgemein)
    0 H H H H H 0
    0 H H H H 0
    32 / 48

    View full-size slide

  119. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Alinierung (allgemein)
    0 H H H H H 0
    0 H H H H 0
    32 / 48

    View full-size slide

  120. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Alinierung (allgemein)
    0 H H H H H 0
    0 H H H H H 0
    32 / 48

    View full-size slide

  121. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Alinierung (im Alltag)
    Taxon N. Sequence
    PLAGIARY 1 die Zurueckhaltung die im Umgang mit dem Foederalismusbegriff
    ORIGINAL 1 die Zurueckhaltung die im Umgang mit dem Foederalismusbegriff
    PLAGIARY 2 zu beobachten ist mag zu einem gewissen ..Teil. darauf zuruec
    ORIGINAL 2 zu beobachten ist mag ..........n.ich.t zuletzt darauf zuruec
    PLAGIARY 3 kzufuehren sein dass sich ...waehre.nd. des 19 Jahrhunderts e
    ORIGINAL 3 kzufuehren sein dass sich im v.e.r.lauf des 19 Jahrhunderts e
    HTL2 1 LDTAPCLFSDGS PQKAAYVLWDQTIL QQDITPLPSHETHSA QKGELLALIC
    Type
    (1)
    Plagiaterkennung (Ausschnitt von Guttenbergs Dissertation)
    33 / 48

    View full-size slide

  122. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Alinierung (im Alltag)
    Taxon N. Sequence
    HTL2 1 LDTAPCLFSDGS‑‑‑‑‑‑PQKAAYVLWDQTIL‑‑‑QQDITPLPSHETHSA QKGELLALIC
    MMLV 1 PDADHTWYTDGSSLLQEGQRKAGAAVTTETEVIWAKALDAG‑‑‑T‑‑‑SAQRAELIALTQA
    HTL2 2 GLRAAKPWPSLNIFLDSKYLIKYLHSLAIGAFLGTSAH‑‑‑‑‑‑‑‑‑QT‑LQAALPPLLQG
    MMLV 2 LKMAEGKK‑LNVYTDSRYAFATAHIHGEIYRRRGLLTSEGKEIKNKDE‑ILALLKALFLPK
    HTL2 3 KTIYLHHVRSHT‑NLPDPISTFNEYTDSLILAPL‑‑‑‑‑‑‑‑‑‑
    MMLV 3 RLSIIHCPGHQ‑KGHSAEARGNRMADQAARKAAITETPDTSTLL
    Type
    (1)
    Sequenzvergleich in der Biologie
    33 / 48

    View full-size slide

  123. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Alinierung (im Alltag)
    Taxon N. Sequence
    WRONG 1 two b‑ or not two b‑ that is the question
    CORRECT 1 t‑o be or not t‑o be that is the question
    WRONG 2 Leavins‑t‑ine distance is the addict distance betwean strings
    CORRECT 2 Le‑venshtein‑ distance is the ed‑i‑t distance between strings
    WRONG 3 ”ad‑ress” ”concensus” and ”dependance” are of‑en misspelled
    CORRECT 3 ”address” ”consensus” and ”dependence” are often misspelled
    Type
    (1)
    Rechtschreibkorrektur
    33 / 48

    View full-size slide

  124. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Alinierung (in der Linguistik)
    Alinierungsanalysen
    34 / 48

    View full-size slide

  125. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Alinierung (in der Linguistik)
    Alinierungsanalysen
    sind relativ leicht automatisierbar,
    34 / 48

    View full-size slide

  126. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Alinierung (in der Linguistik)
    Alinierungsanalysen
    sind relativ leicht automatisierbar,
    fördern die Transparenz der vergleichenden Sprachforschung,
    34 / 48

    View full-size slide

  127. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Alinierung (in der Linguistik)
    Alinierungsanalysen
    sind relativ leicht automatisierbar,
    fördern die Transparenz der vergleichenden Sprachforschung,
    können durch interaktive Software auch leicht manuell nachkorrigiert
    werden und
    34 / 48

    View full-size slide

  128. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Alinierung (in der Linguistik)
    Alinierungsanalysen
    sind relativ leicht automatisierbar,
    fördern die Transparenz der vergleichenden Sprachforschung,
    können durch interaktive Software auch leicht manuell nachkorrigiert
    werden und
    sind daher ein perfektes Beispiel für computergestützte (im
    Gegensatz zu computerbasierter) Sprachforschung.
    34 / 48

    View full-size slide

  129. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Computergestützte Alinierung
    EDICTOR Tool für computergestützte Alinierung (List 2017)
    35 / 48

    View full-size slide

  130. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Computergestützte Alinierung
    EDICTOR Tool für computergestützte Alinierung (List 2017)
    35 / 48

    View full-size slide

  131. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Computergestützte Alinierung
    EDICTOR Tool für computergestützte Alinierung (List 2017)
    35 / 48

    View full-size slide

  132. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Computergestützte Alinierung
    EDICTOR Tool für computergestützte Alinierung (List 2017)
    35 / 48

    View full-size slide

  133. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Computergestützte Alinierung
    EDICTOR Tool für computergestützte Alinierung (List 2017)
    35 / 48

    View full-size slide

  134. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Computergestützte Alinierung
    EDICTOR Tool für computergestützte Alinierung (List 2017)
    35 / 48

    View full-size slide

  135. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Computergestützte Alinierung
    EDICTOR Tool für computergestützte Alinierung (List 2017)
    35 / 48

    View full-size slide

  136. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Computergestützte Alinierung
    EDICTOR Tool für computergestützte Alinierung (List 2017)
    35 / 48

    View full-size slide

  137. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Computergestützte Alinierung
    EDICTOR Tool für computergestützte Alinierung (List 2017)
    35 / 48

    View full-size slide

  138. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Computergestützte Alinierung
    EDICTOR Tool für computergestützte Alinierung (List 2017)
    35 / 48

    View full-size slide

  139. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Computergestützte Alinierung
    List et al. (in Vorb.)
    36 / 48

    View full-size slide

  140. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Phylogenetische Rekonstruktion
    Grundfragen der phylogenetischen Rekonstruktion:
    37 / 48

    View full-size slide

  141. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Phylogenetische Rekonstruktion
    Grundfragen der phylogenetischen Rekonstruktion:
    Wie alt ist eine Sprachfamilie?
    37 / 48

    View full-size slide

  142. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Phylogenetische Rekonstruktion
    Grundfragen der phylogenetischen Rekonstruktion:
    Wie alt ist eine Sprachfamilie?
    Welche Wörter wurden in der Ursprache gesprochen?
    37 / 48

    View full-size slide

  143. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Phylogenetische Rekonstruktion
    Grundfragen der phylogenetischen Rekonstruktion:
    Wie alt ist eine Sprachfamilie?
    Welche Wörter wurden in der Ursprache gesprochen?
    Wo sind Wörter erhalten geblieben, wo verloren gegangen?
    37 / 48

    View full-size slide

  144. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Phylogenetische Rekonstruktion
    Grundfragen der phylogenetischen Rekonstruktion:
    Wie alt ist eine Sprachfamilie?
    Welche Wörter wurden in der Ursprache gesprochen?
    Wo sind Wörter erhalten geblieben, wo verloren gegangen?
    Was sagt uns das Vokabular der Ursprache über die ursprüngliche
    Gemeinschaft der Sprecher?
    37 / 48

    View full-size slide

  145. Computergestützte Sprachforschung Grundlegendes
    Grundlegendes: Phylogenetische Rekonstruktion
    Fúzhōu
    Táiběi
    Xiàmén
    Zhāngpíng
    Mǐn
    Guǎngzhōu
    Měixiàn
    Liánchéng
    Hakka
    Wēnzhōu
    Níngbō
    Sūzhōu
    Shànghǎi
    Shànghǎi_B

    Nánchāng
    Ānyì
    Gàn
    Chángshā
    Shuāngfēng
    Xiāng
    Yàngshān
    Wǔhàn
    Níngxià
    Chéngdū
    Běijīng
    Tàiyuán
    Yúcì
    Guānhuà

    月娘
    月光佛
    月光
    月亮
    月明
    ‘MOON’
    ‘MOON-MOTHER’
    ‘MOON-LIGHT’
    ‘MOON-LIGHT-SUFFIX’
    ‘MOON-SHINE’
    ‘MOON-BRIGHT’
    Geschichte des Worts für «Mond» in chinesischen Dialekten (List 2016)
    38 / 48

    View full-size slide

  146. Computergestützte Sprachforschung Erkenntnisse
    Erkenntnisse des computergestützten Sprachvergleichs
    #MLGA (Make Linguistics Great Again!)
    39 / 48

    View full-size slide

  147. Computergestützte Sprachforschung Erkenntnisse
    Erkenntnisse des computergestützten Sprachvergleichs
    #MLGA (Make Linguistics Great Again!)
    Der Bann von Sprachursprungsfragen durch die Société de Linguistique de
    Paris:
    Die Gesellschaft gestattet keinerlei Diskussion zum Ursprung der
    Sprache oder zur Erschaffung einer Universalsprache. («Statuts»
    1871: III, meine Übersetzung)
    39 / 48

    View full-size slide

  148. Computergestützte Sprachforschung Erkenntnisse
    Erkenntnisse des computergestützten Sprachvergleichs
    #MLGA (Make Linguistics Great Again!)
    Der Bann von Sprachursprungsfragen durch die Société de Linguistique de
    Paris:
    Die Gesellschaft gestattet keinerlei Diskussion zum Ursprung der
    Sprache oder zur Erschaffung einer Universalsprache. («Statuts»
    1871: III, meine Übersetzung)
    Seit der quantitativen Wende stellen wir als Linguisten neue Fragen
    oder trauen uns, lange nicht beachtete Fragen endlich wieder zu
    stellen.
    39 / 48

    View full-size slide

  149. Computergestützte Sprachforschung Erkenntnisse
    Erkenntnisse des computergestützten Sprachvergleichs
    Edit-Dist.
    SCA Infomap
    Bahnaric
    Chinese
    Huon
    Romance
    Tujia
    Uralic
    Turchin
    LexStat
    TOTAL
    true positive
    true negative
    false negative
    false positive
    Akkurazität automatischer Wortvergleiche (List et al. 2017)
    40 / 48

    View full-size slide

  150. Computergestützte Sprachforschung Erkenntnisse
    Erkenntnisse des computergestützten Sprachvergleichs
    Automatische Methoden sollen die Forschungskräfte nicht überflüssig
    machen.
    41 / 48

    View full-size slide

  151. Computergestützte Sprachforschung Erkenntnisse
    Erkenntnisse des computergestützten Sprachvergleichs
    Automatische Methoden sollen die Forschungskräfte nicht überflüssig
    machen.
    Sie sollen den Forschenden vielmehr durch das Übernehmen der
    langweiligen Aufgaben Zeit geben, sich wichtigeren Forschungsfragen
    zu widmen.
    41 / 48

    View full-size slide

  152. Computergestützte Sprachforschung Erkenntnisse
    Erkenntnisse des computergestützten Sprachvergleichs
    Automatische Methoden sollen die Forschungskräfte nicht überflüssig
    machen.
    Sie sollen den Forschenden vielmehr durch das Übernehmen der
    langweiligen Aufgaben Zeit geben, sich wichtigeren Forschungsfragen
    zu widmen.
    Als Beispiel dient hier die moderne Biologie, wie auch die
    computergestützten Übersetzung.
    41 / 48

    View full-size slide

  153. Sprachwandel
    Drüberhinaus
    Jenseits von Sprachwandel
    42 / 48

    View full-size slide

  154. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Lexikalisierung
    43 / 48

    View full-size slide

  155. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Lexikalisierung
    Wie können, sollen, oder müssen wir uns ausdrücken?
    43 / 48

    View full-size slide

  156. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Lexikalisierung
    Wie können, sollen, oder müssen wir uns ausdrücken?
    1 Mir tut der Kopf weh.
    43 / 48

    View full-size slide

  157. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Lexikalisierung
    Wie können, sollen, oder müssen wir uns ausdrücken?
    1 Mir tut der Kopf weh.
    2 Mir dröhnt der Schädel.
    43 / 48

    View full-size slide

  158. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Lexikalisierung
    Wie können, sollen, oder müssen wir uns ausdrücken?
    1 Mir tut der Kopf weh.
    2 Mir dröhnt der Schädel.
    3 Meine Rübe pocht.
    43 / 48

    View full-size slide

  159. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Lexikalisierung
    Wie können, sollen, oder müssen wir uns ausdrücken?
    1 Mir tut der Kopf weh.
    2 Mir dröhnt der Schädel.
    3 Meine Rübe pocht.
    4 Ich hab ein fieses Ziehen in der Stirn.
    43 / 48

    View full-size slide

  160. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Lexikalisierung
    One beer please! A beer for me!
    Beer? Please?
    You have beer?
    I'm thirsty, but I do
    not drink water, can
    you help me?
    I want the same as
    everybody else
    here.
    44 / 48

    View full-size slide

  161. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Lexikalisierung
    44 / 48

    View full-size slide

  162. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Lexikalisierung
    44 / 48

    View full-size slide

  163. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Polysemiedaten
    ID Konzept Russisch Deutsch ...
    1.1 world mir, svet Welt ...
    1.21 earth, land zemlja Erde, Land ...
    1.212 ground, soil počva Erde, Boden ...
    1.420 tree derevo Baum ...
    1.430 wood derevo Wald ...
    ... ... ... ... ...
    45 / 48

    View full-size slide

  164. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Polysemiedaten
    CLICS: Crosslinguistic Colexifications
    - 221 Sprachen
    - 64 Sprachfamilien
    - 1280 Konzepte
    - 301,498 Wörter
    - 45,667 Polysemien (Kolexifizierungen)
    - 16,239 unterschiedliche Links
    - http://clics.lingpy.org
    45 / 48

    View full-size slide

  165. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Polysemiedaten
    684
    678
    871
    1043
    6
    30
    129
    196
    1243
    128
    869
    853
    650 344
    1103
    150
    185
    627
    232
    709
    1035
    1206
    177
    97
    311
    496
    606
    137
    207
    444
    840
    1077
    325
    222
    1063
    1138
    1204
    1258
    559
    723
    495
    766
    914
    38
    1101
    652
    865
    891
    872
    633
    291
    980
    700 144
    410
    430
    1025
    406
    464
    787
    622
    131
    242
    918
    275
    1159
    99
    1174
    671 1038
    786
    705
    641
    760
    1259
    356
    391
    197
    10
    214
    299
    63
    191
    619
    644
    792
    1205
    897 67
    1231
    213
    226
    747
    681
    399
    841
    439
    773
    123
    800
    16
    1067
    1227
    696
    417
    550
    68
    76
    108
    360
    1244
    339
    500
    81
    867
    79
    1097
    98
    96
    833
    771
    715
    455
    380
    1268
    1186
    1046
    39
    252
    1228
    66
    23
    1112
    133
    676
    336
    739 1150
    1071
    986
    485
    112
    372
    1109
    830
    721
    1053
    1057
    601
    573
    556
    527
    1248
    614
    488
    908
    499
    1002
    309
    442
    814
    1193
    569
    458 258
    563
    653
    682 774
    70
    1151
    948
    801
    1082
    243
    47
    71
    83
    153
    1265
    934
    85
    1215
    1199
    523
    581
    422
    21
    358
    1261
    111
    354
    219
    759
    15
    890
    261
    1222
    141
    158
    74
    806
    1031
    845
    770
    850
    903
    1224
    419
    754
    433
    798
    188
    1256
    613
    528
    208
    539
    323
    981
    132
    1055
    1001
    790
    804
    844
    1118
    907
    640 446
    815
    923
    498
    201
    1184
    578
    566
    427
    532
    452
    151
    750
    598
    1094
    345
    735
    777
    978
    599
    492
    390
    286
    1107
    742
    1015
    1202
    1210
    1257 1275
    859
    988
    69
    752
    596
    290
    126
    110
    950
    922
    1047
    741
    253
    347
    385
    620
    966
    221
    431 3
    224
    1194
    999
    953
    1029
    852
    301
    389
    318
    530
    1048
    1032 175
    701 544
    1119
    241
    94
    745
    835
    1270
    62
    107
    159
    20
    767
    512
    331
    248
    549
    1013
    946
    974
    1022 1100
    477
    302
    233
    1168
    1003
    1211
    570
    307 40
    945
    1269
    784
    546
    437
    901
    350
    238
    305
    1191
    482
    1012
    977
    906
    783
    524
    117
    457
    603
    836
    1181
    880
    229 124
    216
    1113
    1074
    72
    586
    647
    447
    2
    113
    1179
    7 1006
    665
    397
    502
    610 1274
    707
    327
    659
    667
    824
    917
    985
    1089
    346
    1229
    101
    542
    1042
    727
    782
    733
    967
    462
    592
    468
    1106
    440
    478 308
    577
    698
    776
    75
    1155
    51
    145
    517
    359
    938
    1157
    1160
    1183
    947
    1102
    1135
    1252
    343
    608
    537
    103
    634
    251
    383 506
    25
    829
    396
    686
    679
    574
    516
    42
    250
    379
    809
    602
    660
    780
    765
    697
    856
    899
    594
    1008
    393
    179
    114
    1140 11
    100
    1209
    618
    600
    192
    1277
    896
    1142
    1278
    762 421
    713
    182
    521
    861
    672
    297
    1116
    1190
    1192
    140
    1212
    46
    493
    1187
    157
    1225
    212
    403
    519
    616
    173
    413
    912
    1110
    84
    756
    793
    636
    118
    889
    692
    998
    366
    711
    1045
    61
    240
    1263
    199
    648
    832
    289
    522
    368
    1091
    931
    982
    949
    400
    119
    388 811
    53 59
    1069
    708
    952
    545
    763
    1238
    184
    825
    377
    1242
    1233
    262
    635
    269
    1062
    1061
    1073
    933
    17
    1247
    352
    64
    384
    50
    632 736
    1246
    822
    781 758 1
    939
    595
    778
    105
    860
    1049
    1066
    1072
    995
    503 370
    919
    1149
    1127
    1128
    972
    1126
    245
    921
    973
    675
    587
    1235
    960
    928 926
    1143
    548
    1250
    86
    1021
    32
    1068
    719
    965
    259
    1070
    863
    638
    303
    324
    873
    249
    892
    976 1007
    722
    36
    459
    293
    165
    209
    557
    1245
    788 862
    651
    900
    31
    483
    236
    935 1052
    115
    294 680
    831
    44
    453
    206
    971
    1273
    170
    753
    256
    1148 200
    450
    382
    1240
    561
    615
    317
    572
    725 870
    438
    139
    1011
    646
    1117
    392
    45
    276 264 704
    1080
    174
    1050
    808
    1197
    508
    576
    225
    562
    471
    1217
    333
    1014
    593
    92
    1034
    611
    1171 312
    802
    1253
    29
    902
    244
    582
    466
    668
    878
    341
    432
    1163
    625
    904
    164
    467 1195
    1232
    796
    828
    281
    629
    349
    1166
    411
    369
    387
    1208
    394
    415
    1000 58
    1098
    148
    287
    1223
    818
    263
    220
    838
    876
    313
    260
    65
    1165
    5 355
    106
    1172
    490
    718
    171
    1139
    163
    785
    881
    887
    1169
    319
    585
    553
    894
    306
    314
    1041
    1009
    799
    674
    848
    1201
    1004
    689
    1085
    1218 1145 1170
    228
    911
    279
    73 104
    690
    1254
    402
    340
    169
    693
    868
    893
    1018
    78
    1092
    194
    555
    198
    834
    1249
    997
    932
    237
    1176 666
    956
    624
    1262
    541
    520
    795
    866
    702
    4
    734
    1095
    1180
    728
    964
    1079 271
    842
    1241
    1056
    154
    751 353
    905
    1136
    504
    909
    910
    1133
    362
    583
    670
    1124 381
    1216
    215
    178
    571
    470
    142
    376
    1154
    172
    296
    533
    364
    963
    152
    797 1213
    803
    1051
    738
    426
    1036
    1153
    637
    823
    915
    428
    1075
    560
    547
    1137
    35
    882
    89
    511
    1122
    805
    494
    1130
    1188
    1086
    1236
    669
    588
    930
    703
    942
    18
    655
    335
    155
    710
    1156
    1028
    465
    147
    183
    414
    1221
    273
    166
    1054
    278
    55
    460
    812 1090
    810
    180
    768
    143
    156
    404
    367
    1182
    231
    288
    136
    456
    82
    529
    970
    1016
    729
    395 187
    604
    408
    330
    1064
    34
    1267
    847
    726
    543
    677
    642
    940
    645
    958
    683 695
    864
    1058 605
    1084
    451
    443
    699
    1167
    959
    925
    1198
    227
    886
    628
    1178
    337
    991
    813
    657
    1185
    1039
    769
    1081
    484
    712
    1189
    944
    1207
    322
    33
    685
    424 80
    270
    937
    1177
    283
    1237
    816
    130
    161
    189
    77
    300
    1026
    463 1104
    326
    589 60
    983
    474
    1093
    744
    748
    554 292
    41
    267
    984
    373
    1214
    957
    1024 969
    507 37
    874
    1030
    630
    579
    962
    535
    706
    688
    122
    497
    1060
    1083
    1027 102
    510 405
    1134
    658
    617
    936
    929
    363
    1175 361
    536
    534
    1219
    181
    386
    884
    418
    558 8
    479
    979
    551
    505
    316
    298
    26
    315
    761
    202
    1144
    176
    473 348 134
    639
    663
    717
    885
    924
    149
    49
    1078
    1040
    57
    167
    764
    1173
    673
    280
    1152
    277
    1272
    1065
    272
    827
    531
    607
    1123
    257
    996
    436 9
    826
    234
    1096
    875
    525
    304
    1108
    475
    1132
    714
    846
    540
    716
    1005
    1105
    357
    1162
    694
    920 743
    28
    994
    1200
    168
    1266
    420
    515
    568
    755
    895
    218
    916
    730
    807 210
    375
    854
    1010
    879
    1125
    268
    1129
    1114
    1255
    1158
    1279
    487
    486
    398
    597
    661
    135 565
    621 193
    321
    1230
    513
    654
    265
    612
    737
    855
    211
    1196
    246
    1264
    584
    338
    749
    1271
    434
    121
    423
    509
    839
    1147
    656
    230
    239
    489
    14
    469
    22
    1044
    351
    448
    282
    329
    961
    254
    989
    371
    284
    223
    843
    821
    24
    1023
    643
    819
    285
    514
    746
    757
    791
    138
    186
    849
    93 951 127
    877
    1088
    518
    1164
    1260
    501
    54
    190
    95
    43 205
    1276
    116
    146 662
    217
    461
    883
    204
    1033
    310
    472
    12
    412
    332
    817
    649
    794
    1037
    943 927
    481
    968
    425
    109 195
    857
    1121
    564
    687
    664
    724
    87
    1120
    88
    449
    429
    255
    987
    992
    1111
    591
    575
    491
    720
    851
    328
    941
    990 1019
    993
    1087
    955
    580
    1226
    975
    1099
    732
    235 779
    365 1234
    441
    609 247
    334 91
    1251
    1131
    913
    691
    52
    274
    1017
    435
    90
    407
    480
    1239
    13
    623
    0
    266
    626
    295
    954
    1059
    552
    898
    858
    772 526
    1115
    48
    1161
    125
    590
    454
    1020
    1141
    203
    740
    1146
    342
    820
    1220
    56
    320
    416
    27
    401
    476
    19
    120
    1203
    445 789
    775
    888
    567
    378
    1076
    160
    162
    409
    731
    631
    374
    538
    837
    45 / 48

    View full-size slide

  166. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Polysemiedaten
    Concept "money" is part of a cluster with the central concept "fishscale" with a total of 10 nodes. Hover over
    forms for each link. Click on the forms to check their sources. Click HERE to export the current network.
    ty: Line weights: Coloring: Family
    silver
    leather
    fishscale
    bark
    coin
    fur
    snail
    skin, hide
    money
    shell
    49 links for "silver" and "money":
    Language Family Form
    1. Ignaciano Arawakan ne
    2. Aymara, Central Aymaran ḳulʸḳi
    3. Tsafiki Barbacoan kaˈla
    4. Seselwa Creole French Creole larzan
    5. Miao, White Hmong-Mien nyiaj
    6. Breton Indo-European arhant
    7. French Indo-European argent
    8. Gaelic, Irish Indo-European airgead
    9. Welsh Indo-European arian
    10. Cofán Isolate koriΦĩʔdi
    45 / 48

    View full-size slide

  167. Jenseits von Sprachwandel
    Jenseits von Sprachwandel: Polysemiedaten
    Concept "wheel" is part of a cluster with the central concept "leg" with a total of 11 nodes. Hover over the e
    each link. Click on the forms to check their sources. Click HERE to export the current network.
    ity: Line weights: Coloring: Geolocation
    sphere, ball
    round
    footprint
    foot
    calf of leg
    circle
    thigh
    wheel
    leg
    hip
    buttocks
    6 links for "foot" and "wheel":
    Language Family Form
    1. Cofán Isolate c̷ɨʔtʰe
    2. Puinave Isolate sim
    3. Yaminahua Panoan taɨ
    4. Wayampi Tupi pɨ
    5. Pumé Unclassified taɔ
    6. Ninam Yanomam mãhuk
    45 / 48

    View full-size slide

  168. Ausblick
    46 / 48

    View full-size slide

  169. Ausblick
    Ausblick
    47 / 48

    View full-size slide

  170. Ausblick
    Ausblick
    Wo wird die vergleichende Sprachwissenschaft in fünf Jahren sein?
    47 / 48

    View full-size slide

  171. Ausblick
    Ausblick
    Wo wird die vergleichende Sprachwissenschaft in fünf Jahren sein?
    Wir werden viel mehr Daten haben, darunter mehr leicht
    vergleichbare Daten.
    47 / 48

    View full-size slide

  172. Ausblick
    Ausblick
    Wo wird die vergleichende Sprachwissenschaft in fünf Jahren sein?
    Wir werden viel mehr Daten haben, darunter mehr leicht
    vergleichbare Daten.
    Die Verwendung von Computern wird noch ein Stück normaler
    geworden sein für Linguisten.
    47 / 48

    View full-size slide

  173. Ausblick
    Ausblick
    Wo wird die vergleichende Sprachwissenschaft in fünf Jahren sein?
    Wir werden viel mehr Daten haben, darunter mehr leicht
    vergleichbare Daten.
    Die Verwendung von Computern wird noch ein Stück normaler
    geworden sein für Linguisten.
    Auch wenn wir die ganz großen Fragen (Ursache des Sprachwandels,
    Ursprung der Sprache, automatische Erkennung von Fakenews) nicht
    lösen können, so werden wir doch mehr wissen, als heute.
    47 / 48

    View full-size slide

  174. Danke fürs Zuhören!
    • Name: Dr. Johann-Mattis List
    • Forschungsprojekt: Computer-Assisted Language
    Comparison. Reconciling Computational and Classical
    Approaches in Historical Linguistics
    • Webseite: http://calc.digling.org
    • Projektdauer: April 2017-März 2022
    • Institut: Max-Planck-Institute für Menschheits-
    geschichte, Jena
    LC
    CA
    COMPUTA-
    TIONAL
    HISTORICAL
    LINGUISTICS
    COMPA-
    RATIVE
    METHOD
    48 / 48

    View full-size slide